SKU: 11130877600

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11130877600

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mommakins
Lexington, US
★★★★★ 1
Horrible, don't buy
Size: 1.8in for Puppy Dogs
I wanted to love these. They had so much potential. It's a good size. It seems like a good shape. But ... 1) first red flag should have been the packaging. It looked like it was a dollar store item that had beenblost on the shelves for years. 2) the rubber is super flexible. I was expecting it to be sturdier. I can flatten the ball without lich force. Maybe that doesn't matter. Naybe flexible is good. But I never got a chance to test out it's durability against a pup because... 3) it smelled. I expected it to smell like rubber, like most rubber toys. Rubber smell is okay. Usually rubber smell goes away. But, this was NOT a rubber smell. It smells like peppermint or something similar. It's like someone sprayed essential oils when mixing the rubber and now the smell will not leave. I soaked it in dawn soap half the day and overnight. I rubbed. I scrubbed. The smell actually gets worst the more you scrub it!!! It's like a scented marker or scented eraser, but you do NOT want the scent in a dog toy! My dog cannot smell the food in it because the smell of the weird mint-like scent is so overpowering. He saw it had food, and wanted it, but every time he started sniffing wildly, he would recoil. Whoever thought it was a good idea to scent this was WRONG. Mint in the form of an essential oil is extremely poisonous to dogs!! So, why they would put a mint-loke scent ijto the dog's rubber treat toy is beyond me. I would return this if I hadn't throw out the package immediately. I considered pulling the package out of the trash once i realized the scent issue but other trash had already been dumped into the trash can over it and i didn't want to dig through trash. The ball is still soaking in soap. I scrubbed again this morning. I let obe dry out. No luck. It actually seems to get worst the more you scrub, like it really is embedded in the rubber itself. Yuck!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2022
K
Verified Purchase
Karina Z.
Pawtucket, US
★★★★★ 5
Perro 🐶 happy
Color: Yellow and Purple
Dior Emocionado con sus chanclas para remorder
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
T
Verified Purchase
TN doc
Battle Creek, US
★★★★★ 5
Excellent, unless your pup is a dedicated destructo-dog!
Color: Yellow and Orange
I purchased this twice for a young puppy. She loves these slippers, and they are quite resistent to her piranha teeth. The same can't be said for my adult Golden Retriever, who destroys almost every toy; it's one of his missions in life. A slipper accidently found its way to him, and he shredded it within about 45 minutes. I have to say that I'm surprised it lasted that long, attesting to its relative durability. Overall, I recommend these for most dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
A
Verified Purchase
Anm
Phoenix, US
★★★★★ 1
Dangerous.
Color: Purple
Died in about 2 days. Dogs chewed it to bits and then tried to swallow the pieces. Would not recommend for pet safety. I don't have big dogs, I have littler puppies (3 and 5 months) - would likely have died instantly with big chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
B
Verified Purchase
Betty Green
Los Angeles, US
★★★★★ 3
Disappointed they didn’t hold up long before pieces was being chewed off.
Color: Yellow and Purple
My minature poodle loved them till she started chewing pieces off of them so we had to dispose of them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products