SKU: 11577532710

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding prtein, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Ala2 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding prtein, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Ala2-Ile250, with C-10*His)
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 27.8kDa Actual: 28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11577532710

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
STEVE
Lexington, US
★★★★★ 1
Don’t but this…
Color: Black, Color: Black
The holder came quickly and isn’t that bad but mounts with a huge adhesive backing, which again isn’t;t bad, but it was sent in a plastic bad, like a zip lock bag. The adhesive backing has NO protecvtyive strip on it, so it is covered in lint and debris and was sticking to the bag it was sent in.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
A
Verified Purchase
Andre B
Chelsea, US
★★★★★ 5
Cable management
Color: Black
Great solution
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
B
Verified Purchase
Bisharah Kakish
Houston, US
★★★★★ 4
I just hope it will last for a long time
Color: Black*2
The material is not cheap, I mean it’s a really good silicone! Very easy to use out of the box, and it did fit two of my bricks. All I hope is that it will last for a long time stuck under my desk since I had to stick my bricks upside down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
D
Verified Purchase
DB
Chelsea, US
★★★★★ 5
Works great. Keeps things nice and tidy.
Color: Black, Color: Black
Works great! I regularly use the end of my dining table as a spot to use my laptop and really wanted a more organized way of keeping the cord tidy. This of course would also easily work on a desk as well It's completely made from a nice stretchy and durable silicone and could accommodate pretty good size chargers. My charger is pretty small so it doesn't fit tightly, but it still works perfectly. It's also super easy to install. The reverse side of this has really strong adhesive to hold onto whatever flat surface you attach it to. Mine is adhered to the underside of a wood table and so far it doesn't appear to have any issues with it. I should mention that since it's held on by adhesive, it's not something you can easily move after installed, so put it where you want it to permanently be. That said, for the price you can easily get a second or a third one if you need it in multiple locations. Overall, it works great and it really keeps my laptop charger off the floor and everything is nice and tidy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2025
E
Verified Purchase
ENF
Grantham, US
★★★★★ 3
Nice, BUT a few mounting holes would have made it 5 stars!
Color: Black*2
These seem to be fine but since I have to use this to hold a power brick to a wood joist which is NOT smooth, the included adhesive back is not something that will hold securely! I ended up have to screw two wafer head screws through the rubber backing and into the joist to hold the holder to the wood joist securely. If they put some thought into the design, it would have been nice, if they had incorporated a few mounting holes, which would have taken care if this being mounted to items that are not smooth such as a wood joist or other rough surfaces!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products