SKU: 13349244771

CD40 Fc Chimera Protein, Human

Sale price$170.10 Regular price$189.00
Save 10%

Pay in installments of $47.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

50-60kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13349244771

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stephanie Rager
Louisville, US
★★★★★ 5
Good For Heavy Chewers So Far
Color: Onyx Black - Most Durable
Solid quality. My Doberman is a power chewer and I am looking for a toy that he can't destroy in 2 seconds. If a ball lasts more than an hour it is a miracle. It has a sturdy design and is more heavy weight than the other "non-destructible" balls he has. He has only had his ball for one day so we will see how long this ball lasts him. It is the size of a tennis ball, firm, little to no bounce, and seems built for heavy chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
S
Verified Purchase
Scott Gromaski
Lake Worth, US
★★★★★ 5
Great Product, 2 years and running!
Color: Onyx Black - Most Durable
It’s been almost 2 years and my dogs haven’t destroyed them yet. I have a Pitbull and a Pit/Cosro mix. They destroy every toy we’ve given them, except these toys. Great product 100% worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
T
Verified Purchase
Tony Ahearn
Dallas, US
★★★★★ 5
Perfect for HEAVY chewers
Color: Onyx Black - Most Durable
My dog is a heavy chewer. Destroys everything that’s not very hard rubber, hard plastic, or hard material. He LOVES this ball. I think it’s his favorite. Plus, it bounces great so you can play with your dog. Very well constructed- probably indestructible or will at least last a very long time. Easily worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026
E
Verified Purchase
Evan J.
Battle Creek, US
★★★★★ 5
The only toy my dogs can’t destroy and love
Color: Onyx Black - Most Durable
I am thrilled to have found one toy my dogs don’t destroy immediately. They have torn up Fenrir hammers, the black kongs of all sizes, the monster k9 stick, nylabones, and they don’t like the goughnut at all (it stinks like a bad tire). This is the first one they both love and haven’t been able to destroy immediately. It does allow little tooth marks, but that’s what makes it fun for them. They are very happy playing with it and I’d say this one was worth every dollar. Update Months Later: We’ve gone through 2/3 now. I got two initially, and one has lasted long term. They still haven’t completely destroyed it. They did destroy a second one quickly so I suspect a flaw in it. They sent me a new one and they took a while, but they did destroy the third to the point we had to throw it away. Despite that, one still remains and our dogs still love it. It’s still the best for the money compared to others. We have two Bully XL’s that are each close to 100 pounds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2024
M
Verified Purchase
M. B.
Lowell, US
★★★★★ 5
Indestructible
Color: Onyx Black - Most Durable
This is actually indestrutible! Be careful though, it's wicked hard/heavy. It isn't a ball you want banging into things. Use outside!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products