SKU: 13681132208

Rat IgG kappa A, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat IgG kappa A, His tagProduct Specification Species Rat Synonyms Ig kappa chain C region, A allele Accession P01836 Amino Acid Sequence Protein sequence (P01836, Ala1 Cys106, with C 10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa Observed MW: 15, 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Rat
Synonyms Ig kappa chain C region, A allele
Accession P01836
Amino Acid Sequence

Protein sequence (P01836, Ala1-Cys106, with C-10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 15, 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG antibodies are large globular proteins made of four peptide chains; two identical γ (gamma) heavy chains of about 50 kDa and two identical light chains of about 25 kDa. light chain (L chain) refers to the small molecular weight peptide chain in immunoglobulin. According to its structure and the antigenicity of the constant region, it is divided into two types: kappa light chain and lambda light chain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13681132208

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jonathan Hinshaw
Boise, US
★★★★★ 5
The Truth Shall Set You Free
Format: Paperback
Easy read, really really really good! Everyone should have this! Christians and non-Christians should all have this book and give a read. It’ll change your view of God and bring you closer to Jesus!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2025
T
Verified Purchase
TomOesterman
West Palm Beach, US
★★★★★ 5
A Must Read For Every Christian
Format: Kindle
I first learned of the author, Arthur Meintjes, from Andrew Wommack's ministries. After listening to several of Arthur's messages, which are available at his Kingdom Life Ministries' website, I decided to purchase his book. The Kindle version is easy to read between my computer and my phone. The message Arthur presents is clear, God is not angry with me. Arthur along with the Holy Spirit has replaced my vision of God as a stern Judge that I must obey into God the Father who loves me. Since performance is not required for His love, I now can rest easy in His presence. My life is now dedicated to getting to know the Father through the Son with the guidance of Spirit. AMEN! Arthur, thank you such a wonderful book. May the Lord continue to bless you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2013
J
Verified Purchase
JLS
Houston, US
★★★★★ 5
This is one of the best books I have read in years
Format: Paperback
This is one of the best books I have read in years. Arthur Meintjes is a joyful teacher who concentrates here on the essence of the Gospel. You will loose your "religion" and gain your rightful relationship with your heavenly Father with a renewed understanding. As a pastor I highly recommend this to churches, small groups, pastors (in particular) and anyone teaching others. In fact I recommend it to anyone who does not feel comfortable with God the Father. You'll find through scripture that our Father God is not the angry being that is always half ready to kill us, or that barely tolerates us, and find that Jesus was the exact representation of our Father, and this is Good News. Highly Recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2017
B
Verified Purchase
Bob
Houston, US
★★★★★ 5
Intimacy with Father God!
Format: Kindle
Wonderful teaching on the relationship Gods the Father wants worth you; Jesus Christ as an example of that relationship—if you know Jesus, you know the Father and vice-versa. God the loving Father!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2021
E
Verified Purchase
Eva Claire
Lexington, US
★★★★★ 5
More Revelation!
Format: Paperback
God is so faithful to bring more revelation to you if you are seeking Him! He speaks to us directly in prayer, through creation, through His Word and through other like minded seekers/believers. Holy Spirit used this book to answer some of the important questions and deep longings that I have had for most of my life..... This book has been a blessing to me and I hope it will be a blessing to you also :o)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2022

recommand products