SKU: 13699771146

Biotinylated BCMA Fc&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal Human IgG1 Fc &Avi tag

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

38-45kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13699771146

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Charles
Carnegie, US
★★★★★ 5
Solid primer well worth the cost.
Format: Kindle
Let's start with the understanding that I was not looking for War and Peace, here. I have always enjoyed the Sam's Teach Yourself in X Hours format, and this is another that gets the balance between what is needed to use the tool well and what is too much information for a beginner right. I was looking for something that could introduce me to this engine, giving enough understanding of the system to allow me to make games with normal use of the internet to get into the fine detail. This book is exactly what I was looking for. It introduces the engine and its main components and the general theory behind them, getting you up and running quickly. While the engine seems to be gathering a following, there is not a lot of material out there for it. This book covers the topics well enough to get functionally proficient without getting so far into the weeds that you would not finish it. The lessons are broken up in a way that makes sense, and there are full game exercises. I really liked the fact that the exercises follow the theory, so you are not simply walking through a bunch of actions that you do not understand, as happens in many "learn by making a game" tutorials. The writing and editing leave some to be desired, but did not get in the way of understanding.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2018
C
Verified Purchase
cybereality
Birmingham, US
★★★★★ 5
Simple and Amazing! A Great Introduction to Godot For Aspiring Game Developers
Format: Kindle
Godot Engine Game Development in 24 Hours is a fine introduction to the Godot game engine, and quite an extensive look at the software. The book is 432 pages, and there is a wealth of information contained here. I’ve just started working with Godot myself, so much of the material was new, but it was explained clearly so anyone can understand. If you are interested in exploring Godot, this would be a excellent buy on your journey. If you are familiar with the Sams 24 hour books, they basically have 24 chapters each focused on a different aspect of the topic. The chapters are not long, and certainly would not take a hour to read each, but it’s good marketing I guess. In any case, I did enjoy that a range of areas were covered. So what’s in the book? We get a look at the scene system, 2D graphics, scripting, a few game demos like a space shooter (2D) and Bloxorz clone (3D), and a networked Bomberman clone (2D). Scripting, input, physics, user interface, project management, materials and shaders, light and shadow, environments, sound, particles, networking, and a bonus 25th chapters about using native code. Yeah, quite a survey for 400 pages. I felt like the authors expect some basic understanding of programming, but otherwise you do not have to be an experienced game developer to get value out of the book. Everything is explained simply and I did not notice any glaring errors. I really enjoyed that there were some simple game demos included, so readers could get a better idea of what a more complex project would look like. It also didn’t hurt that one of the authors co-created the engine, so I bet he knows what he’s talking about. All in all, a great book. As I said, I am just starting with Godot and this is the first book I have read on it. Seems like an awesome introduction and much more palatable than reading the documentation (though I will note that the Godot docs are high quality, it just can be daunting). So I can fully recommend this book to anyone interested.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2019
B
Verified Purchase
bOB wALTERS
Natrona Heights, US
★★★★★ 4
Worthwhile book
Format: Paperback
This is a good book on a promising game engine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2018
D
Verified Purchase
David Taylor
Phoenix, US
★★★★★ 5
If you're developing games with Godot, you need this book
Format: Paperback
Godot is a fantastic game engine, and it has lots of aids to learning -- written tutorials, video tutorials, sample projects, one of the best manuals I've ever encountered. Still, it's nice to have a physical book you can hold in your lap, make notes in, and use as an overall guide to developing competence in Godot development. This is that book. It's has a logical flow, has genuinely useful sample projects, and is written in a clear, highly accessible style. If you are learning Godot, you can't do better than this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2019
L
Verified Purchase
L. Hall
Lake Worth, US
★★★★★ 5
I didn’t really get a full grasp until reading the philosophy behind Godot.
Format: Paperback
Well paced and very readable. I worked through the online tutorials before buying this book but didn’t really get a full grasp until reading the philosophy behind Godot. Though I have been a C programmer for 34 years, and a Java developer for 22 years, and a Python developer for 18 years, I have never been seriously interested in a game engine until my son introduced me to Godot a couple of months ago. Godot is tremendous! I have even used Godot’s UI controls to produce wireframes for business apps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 24, 2019

recommand products