SKU: 13797946226

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13797946226

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Greg Collins
Pawtucket, US
★★★★★ 5
Great deal for the money, look sharp, and very sturdy
Size: 32in-Shelves, Size: 32in-Shelves
I was looking to create pipe shelves in our living room. After spending some time researching prices for pipe and wood, I determined that I would save money by buying a couple sets of these shelves. When the shelves came in, I was happy to learn that they were indeed good quality and easy to assemble. They come with mounting hardware, but I’d recommend better mounts for the walls than the ones supplied. Overall, I love the look of these shelves. The wood is described as reclaimed, but it’s pretty much cheap, light wood with a stain. They still look good and are sturdy. The pipes has some silver paint brushed on them to give them a distressed look. I thought it was actually a little cheesy looking, but I happened to have iron-colored spray paint, so I just respirated them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2020
L
Verified Purchase
Leasa Segura
Dallas, US
★★★★★ 5
Modern Farmhouse Towel Rack
Beautiful. Sturdy. Shelves have enough depth to be useful. Would buy again. Great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025
D
Verified Purchase
Deborah
Waukegan, US
★★★★★ 5
Pretty good quality.
Size: 32in-Shelves, Size: 32in-Shelves
My husband and put this together and hung pretty easily. Instructions are clear. It helps to have a drill bit. Good quality, good look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
D
Verified Purchase
Darrell Daniel
Omaha, US
★★★★★ 4
Looks good but the wall anchors is TRASH!
Size: 3-tier shelves, Size: 3-tier shelves
The product is heavy and sturdy once you get it up completely. The issue I have is with the instructions... 1. The 5/16 drill bit is recommends is WAY TO BIG. The Anchors it comes with will slip right through. The screws that is comes with are WAY TO SMALL for the weight. I recommend getting better ones from the hardware store and painting the screws black for better aesthetics. 2. The instructions say to put it together first then hang it on the wall. That is great so you can see where you want to place it and because it is actually bigger than it looks, but you will need to de-assemble it from the bottom shelf down after you mark where you want to place it, then put that part on the wall, then reassemble it from there, securing the top part to the wall last. The instructions sucked but that is what worked best for me. Another thing is when you first assembling it, you will notice that you will have to unscrew it a bit so the pipes can fast the correct way. This will make it feel flimsy, but it will tighten up when you secure it to the wall. Also, like some people said in previous reviews, some of the black paint did peel off the pipes, not to much for me but it was noticeable if you look at it hard enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2023
E
Verified Purchase
Eileen
Fort Morgan, US
★★★★★ 5
Love the look of these
Size: 24in-Shelve
I love the look of these. Bought for towel storage over my toilet. They look really classy and I'm so happy with them. However, its important to note that the wall anchors they provide are way too big for the screws. The screws just fall into the inside of the anchor without even being screwed in. So there's no way you could secure the wall unit with the ones provided. We had to replace the anchors with some I already had. Other than that very happy with the quality and look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2025

recommand products