SKU: 15225050559

CD155/PVR His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD155/PVR His Tag Protein, MouseProduct Specification Species Mouse Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5 Accession Q8K094 Amino Acid Sequence Asp29 Leu348, with C terminal 8*His

Product Specification


Species Mouse
Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5
Accession Q8K094
Amino Acid Sequence

Asp29-Leu348, with C-terminal 8*His DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 50-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Liu Lu ,Wang Ying ,Geng Chen,Wang Aihong ,Han Sai ,You Xuewu ,Sun Yu ,Zhang Junhua ,Lu Wei ,Zhang Youzhong. CD155 Promotes the Progression of Cervical Cancer Cells Through AKT/mTOR and NF-kappa B Pathways. [J] FRONTIERS IN ONCOLOGY.2021-07-05(11).

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15225050559

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristina
Belleville, US
★★★★★ 4
Great value
Size: 18-26 Expedition, 15-26 F-150, 18-26 Navigator
The engine air filter fit perfect. The cabin air filter was a bit of a challenge fitting. seemed to be a bit larger but it went in and got the cap back on the box. For the price you cant beat it. Would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
S
Verified Purchase
Storyteller
Massapequa, US
★★★★★ 5
Great Filter Set for Allergy‑Sensitive Families and MPG‑Minded Drivers
Size: 21-25 TLX, 18-25 Odyssey
I bought this set because I prefer handling routine maintenance myself, especially cabin and engine air filters, rather than paying dealership prices for simple jobs. The package included one cabin air filter and one engine air filter, plus a full backup set for the next service interval. Both filters installed easily and fit the 2018 Honda Odyssey exactly as expected. No trimming, no forcing, and no alignment issues. The cabin filter seated cleanly in the glove‑box housing, and the engine filter dropped into the airbox without any airflow restriction or sealing gaps. This setup is ideal for Odyssey owners who want to maintain optimal cabin air quality—especially helpful for families with allergies—and for drivers looking to keep engine airflow unrestricted for the best possible MPG and throttle response. It may not be necessary for anyone who relies exclusively on dealership service or doesn’t perform their own maintenance. Overall, this is a straightforward, high‑value filter set that installs cleanly and supports both air quality and engine efficiency for DIY‑minded Odyssey owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
T
Verified Purchase
Tom Crum
Battle Creek, US
★★★★★ 5
Auto air filters
Size: 16-22 Pilot, 14-16 MDX
Perfect - product great - installation easy and much cheaper than having dealer or auto shop do it ——
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
D
Verified Purchase
Dave H.
Boise, US
★★★★★ 5
Easy to DIY
Use YouTube to see how to easily replace these two filters. Honda wanted $130 to replace them. I saved more than $100 buying them and doing it myself in about 5 minutes total time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
D
Verified Purchase
Derf Reese
Grantham, US
★★★★★ 5
Good purchase.
Great product and value. I will always reach for these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products