SKU: 15249003076

CEACAM-3/CD66d Fc Chimera Protein, Human

$279.00 $310.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-3/CD66d Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282
Accession P40198
Amino Acid Sequence

Lys35-Gly155, with C-terminal Human IgG1 Fc KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight

45-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805.

2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691.

3、Hasselbalch H C. et al. (2011) High expression of carcinoembryonic antigen-related cell adhesion molecule (CEACAM) 6 and 8 in primary myelofibrosis. Leukemia Research.

Background

Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15249003076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tyler
Phoenix, US
★★★★★ 5
Thoughtful, Challenging, Research-Based, and Compelling: Joash P. Thomas' "The Justice of Jesus"
Format: Paperback
I cannot recommend this book enough! Especially for Christian's actively involved in a church community. In The Justice of Jesus, Joash offers a compelling and challenging vision of what authentic, Christ-centered justice truly looks like. What I loved most about this book is how directly Joash engages with the reader to reflect on what justice means, what it looks like, and why that can sometimes be an uncomfortable topic, especially for White, Western Christians like myself; and Joash masterfully addresses the topic in a way that's sensitive yet direct and firm, allowing readers from all backgrounds to thoughtfully consider his argument without feeling targeted or turned off. I also really appreciate the quality of his evidence and argument, especially as it relates to anecdotal experience. He provides countless examples of Church communities engaged in the work of justice Jesus' way. There is so much I wish I could dive deeper into, but one of the key takeaways from this book that I appreciate is that, as hard and uncomfortable it can be to acknowledge, Christian's in the West (especially white) are deeply privileged and carry with them a colonized theology that's more often led to harm, oppression, and violence than it has to love, peace, and brotherhood. We've over emphasized the salvation of souls to the detriment of care for physical bodies, perfectly content to keep people in bondage so long as they say some magic words or profess belief. Joash rightly challenges this, calling on Western Christian's to 1) acknowledge their privilege and history of colonial conquest, 2) hold freedom of the body just as highly as salvation of the soul, 3) prioritize unity as beloved children of God over theological/liturgical differences, and 4) do the hard work necessary to address the harm our past has done (a task for which Joash provides many examples/suggestions) as we move forward as the Body of our Lord. Joash includes thoughtful reflection questions at the end of each chapter, making this the perfect book for a book group or study. I recommended it to the pastor of my church and look forward to engaging with it even more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
M
Verified Purchase
M Summers
Louisville, US
★★★★★ 5
Profoundly helpful!
Format: Paperback
I lead book studies centered on social justice and Joash’s work is powerful and refreshing! Fresh perspectives, practical tips, & convicting truths rooted in the Good News of Jesus. Each member of the study has said again and again how good this book has been! Thank you Joash!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
D
Verified Purchase
D. Griffin
Boise, US
★★★★★ 5
Worthwhile read.
Format: Kindle
The first few chapters would perhaps been worth 10 stars the remaining chapters not so much although it was good information. It became a bit monotonous but all in all it’s still a five star book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
J
Verified Purchase
James Parker
Lexington, US
★★★★★ 5
Open our eyes
Format: Paperback
I recently finished reading Joash's very insightful, inspirational, and encouraging book.  I hope it is read and implemented far and wide.  His interpretation of Jesus and "the church" is as close to the spirit of Scripture as I can find.  Twenty years ago, I read "Jesus and the Disinherited" by Howard Thurman that led me to places and situations and cultures and events which were not part of my own life's context. It was Jesus' context and I began to understand his lessons through his eyes instead of my own.  Joash, like Howard Thurman, is right - we colonized, Caucasian, Western civilization folks just don't get it.  But we should and we need to. Open your mind to read this book and see things through God's eyes. Thank you Joash!! We should all look for ways to extend this teaching to others. "...thy will be done, on Earth [all of earth and humanity] as it is [and will be] in Heaven.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2025
C
Verified Purchase
Christopher W. Lilley
Lexington, US
★★★★★ 5
A Bold, Pastoral Call to Decolonize the Gospel
Format: Paperback, Format: Paperback
When I began my journey of theological deconstruction, I quickly realized that shedding the harmful elements of conservative white evangelicalism wasn’t enough. The deeper I went, the more I saw how white Christianity remains entangled with colonial narratives that uphold social and sexual hierarchies and distort the liberating truth of the Gospel. Rev. Joash Thomas’s *The Justice of Jesus* is the book I didn’t know I needed. His voice has profoundly shaped my theological imagination, and this work is a masterclass in liberation ecclesial theology. With clarity and courage, he names the perversion of white, colonialist, slaveholder theology and invites readers to confront its lingering presence in our churches, our pulpits, and our lives. What sets this book apart is its balance of prophetic fire and pastoral tenderness. Rev. Joash never veers into cynicism or outrage for outrage’s sake. Instead, he offers practical, Spirit-led guidance for reclaiming the Gospel from the sin of colonialism and whiteness. He casts a vision of Eucharistic unity, a table wide enough to defy empire and deep enough to hold our collective liberation in Christ. This book emboldened me to use my voice and privilege to pursue the decolonization of theological practice in my own context. I cannot recommend it highly enough to anyone seeking a Gospel that liberates, heals, and restores.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025

recommand products

Robern M Reserve M Series Reserve Cabinet, 20" x 36" x 4", Polished Edge
712.12
Robern M Reserve M Series Reserve Cabinet, 16" x 40" x 6", Polished Edge, Electric Upgrade
1154.62
Robern M Reserve M Series Reserve Cabinet, 16" x 30" x 4", Bevel Edge, Electric Upgrade
824.62
Robern Engineered Stone Top Quartz Stone Vanity Top, 43" x 3/4" x 22", Right Offset Undercounter Sink, Single Hole
1004.62
Robern Engineered Stone Top Quartz Stone Vanity Top, 13" x 3/4" x 19", Dry Top
460.88