SKU: 16216972906

Human SV2A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SV2A Protein, His TagProduct Specification Species Human Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736 Accession Q7L0J3 Amino Acid Sequence Protein sequence (Q7L0J3, Try480 Thr590, with C His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT Expression System HEK293 Molecular Weight Predicted MW: 14. 7 kDa Observed MW: 25 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736
Accession Q7L0J3
Amino Acid Sequence

Protein sequence (Q7L0J3, Try480-Thr590, with C-His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT

Expression System HEK293
Molecular Weight Predicted MW: 14.7 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Synaptic Vesicle Glycoprotein 2A (SV2A) is a membrane protein found in all synaptic vesicles, the organelles responsible for storing neurotransmitters in neurons. It is the ubiquitous and primary isoform of the SV2 family. SV2A plays a critical role in regulating the exocytotic release of neurotransmitters. It is essential for priming synaptic vesicles, a process that makes them ready for calcium-triggered fusion with the presynaptic membrane. It is the direct molecular target for the anti-epileptic drug levetiracetam, underscoring its therapeutic significance in modulating neuronal excitability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16216972906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natasha Spencer
Natrona Heights, US
★★★★★ 3
Cheap
Size: 6FT*6FT, Color: Black
They serve their purpose as long as you leve them in one place and not moving them around and they're kinda flimsy and some of the velcros are cut too short and can't stay closed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
J
Verified Purchase
Jennifer D
Los Angeles, US
★★★★★ 5
Really adorable & functional room divider! I love mine!
Color: Dark Coffee, Size: 4 Panel
Really beautiful divider. I use it out on my patio at my apartment building to provide privacy, shade & keep my things safe. At 6 foot tall and 4 panels (I strongly suggest 4 panels) it's quite a lovely addition to my home. It's delicate so handle carefully but it comes completely put together & just set it up. Being able to move it inside or outside or wherever because it's so light makes it very mobile. It's not too opaque you can see through it but if it's for total privacy use a tablecloth or something behind it to make it less see through. It's strong and big and I had a question for their cs and they responded immediately and handled it right away which is a sign of a good company. It's light so make sure you secure it if it's windy for stability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
Amazon Customer
Lake Worth, US
★★★★★ 5
Nice Look
Color: Dark Coffee, Size: 8 Panel
Attractive and Very versatile. Pretty sturdy, but use care if you buy larger screens when moving. Hinges are small so moving it recklessly could break them. Overall I would recommend this screen. I love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
A
Verified Purchase
Agnes
Lowell, US
★★★★★ 5
Beautiful folding screen😊
Color: Light Beige, Size: 3 Panel
Well made and perfect height I needed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
N
Verified Purchase
Nuke
Natrona Heights, US
★★★★★ 4
I Like it...Perfect sunscreen to keep the Sun off me: I Need To Test Outside Durability
Color: Natural, Size: 4 Panel, Color: Natural, Size: 4 Panel
I have Southern exposure on my 6th story balcony. For most of the year, the Sun out there is unbearable. I have had another room divider/sunscreen I have outside in all weather conditions for 9 years...and it has held up well and still going (but showing age). Hoping this one will be as durable. I will update my review after some weather conditions have put it through its paces. The divider is quite attractive and lightweight. It is perfect for what I need it for at this time, and is stable in the wind with the anchoring system I have used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 30, 2024

recommand products