SKU: 17589458162

Human CKM, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CKM, His tagProduct Specification Species Human Synonyms Creatine kinase M chain, Creatine phosphokinase M type (CPK M), M CK, CKMM Accession P06732 Amino Acid Sequence Protein sequence (P06732, Met1 Lys381, with C 10*His)

Product Specification


Species Human
Synonyms Creatine kinase M chain, Creatine phosphokinase M-type (CPK-M), M-CK, CKMM
Accession P06732
Amino Acid Sequence

Protein sequence (P06732, Met1-Lys381, with C-10*His) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 44.8 kDa Observed MW: 45, 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Creatine kinase, muscle also known as MCK is a creatine kinase. The protein is a cytoplasmic enzyme involved in cellular energy homeostasis. The protein reversibly catalyzes the transfer of "energy-rich" phosphate between ATP and creatine and between phospho-creatine and ADP. Its functional entity is a MM-CK homodimer in striated (sarcomeric) skeletal and cardiac muscle. In heart, in addition to the MM-CK homodimer, also the heterodimer MB-CK consisting of one muscle (M-CK) and one brain-type (B-CK) subunit is expressed. The latter may be an important serum marker for myocardial infarction, if released from damaged myocardial cells into the blood where it can be detected by clinical chemistry.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17589458162

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kris
West Palm Beach, US
★★★★★ 4
Great product
Really helps with eczema! Yes it can be a little gritty but if you use your fingers and heat it up a little the grittiness disappears. Great item to leave in your purse, car or desk in case the eczema itch starts up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026
M
Verified Purchase
Makayla
Birmingham, US
★★★★★ 5
Great for toddler eczema
Such a nice on-the-go option! We leave this in the car for quick application when my daughter’s eczema on her ankles starts acting up (she’s 2 and will scratch it while in her car seat). It helps almost instantly to minimize irritation. The consistency is smooth, doesn’t melt in the warmth, absorbs fast, and has a neutral smell. Very happy with this product and will buy more when we run out!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
H
Verified Purchase
HaileyRae
Lexington, US
★★★★★ 5
It's a YES. Love this stuff.
I usually don't write reviews but... this stuff is amazing for me. I don't have eczema but I needed a face lotion that didn't break me out since Iv'e been having problems with acne lately. I used this awhile ago and tried other products but nothing worked like this. It is so gentle on my face and also IT REMOVES EYE MAKEUP, which is a real game changer for me since even showering cannot take off my mascara at times. But this just swipes it away completely as well as moisturizes which is perfect. Skin feels soft and no irritations, it also lasts forever but keep it out of the heat because it will melt if it gets too hot. It is similar to stick sunscreens IMO and has a bit of a gritty texture at times but it is not abrasive and goes on smoothly. Smells like lavender but is not too overpowering of a smell. The ingredients are really clean too which is hard to find nowadays. For this price, I will be coming back from now on. This is a winner for me!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2025
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 3
smells like lavender, but otherwise good
smells intensely of lavender, which I do *not* enjoy. it's not added just as a perfume, so they're claiming it's unscented, but the lavender smell will definitely follow you around. texture is a little sandy and crumbly (think like a Burt's Bees chapstick texture instead of a smooth Chapstick brand one), which I actually like, it feels like it really applies well instead of just gliding on top of the skin. smooth once it's on the skin, transfers and wipes off easily but that's expected of a balm, and it's easy to reapply. definitely a good size for the price, but the stick is so big that it's actually a little unwieldy to apply on eczema around the hands or face. it works moderately well for my eczema patches, but honestly the lavender smell is so strong and off putting to me that I'll probably give it away anyways.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
C
Verified Purchase
criscostick
Carnegie, US
★★★★★ 5
Perfect for dry, sensitive skin
I have extremely sensitive, dry skin. I also hate the feeling of oily lotion on my hands. I love using this stick so I don’t have to get the lotion on my hands and it hasn’t irritated my skin at all. It is extremely thick and sometimes hard to spread on without it being clumpy, but that’s not an issue for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products