Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 9 - Jul 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human VEGF 121, His tagProduct Specification Species Human Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 15. 7kDa Actual: 16kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Accession | P15692-9 |
| Amino Acid Sequence | Protein sequence(P15692-9, Ala27-Arg147, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH |
| Expression System | CHO |
| Molecular Weight | Theoretical:15.7kDa Actual:16kDa |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Vascular endothelial growth factor (VEGF-121) is a naturally-occurring VEGF-A splice variant involved in embryonic vasculogenesis and angiogenesis. VEGF binds to VEGFR-1 and VEGFR-2, and activates Raf/MEK/ERK and PI3K/AKT pathways. VEGF-121 is released as a freely diffusible protein by a variety of normal and transformed cells. It plays an important role in neurogenesis both in vitro and in vivo. It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. VEGF also promotes growth and survival of vascular endothelial cells, monocyte chemotaxis, and colony formation by granulocyte-macrophage progenitor cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy