SKU: 1810816117

Human E-selectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1
Accession P16581
Amino Acid Sequence

Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 60.3 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1810816117

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BILL T.
Lake Worth, US
★★★★★ 1
NO CURTAIN HOOKS
Colour Name: 1a. Clear, Size Name: 182.9W x 213.4L cm (1 Panels)
Why sells shower curtain without curtain hooks?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 11 December 2024
M
Verified Purchase
Mary Kate
Alexandria, US
★★★★★ 5
Compact, Powerful, and Long-Lasting Handheld Fan with Extra Features
Color: Pink
I took this little handheld fan to a concert in mid June last year and absolutely loved it. It is small, easy to carry, and holds a charge really well. I have probably used it for over 3 hours on both low and high speeds, and it is still going strong on a single charge. I also really like that it doubles as a battery charger and a flashlight, which makes it super convenient to have on hand for different situations. Another great feature is the safety design. The blades automatically stop if anything comes into contact with them, which is appreciated. Overall, this is a great portable fan that I would definitely recommend, especially for concerts, travel, or hot days outside.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
D
Verified Purchase
Dorothy
Birmingham, US
★★★★★ 5
It’s a super good product! Compact but mighty!
Color: Brown
Don’t let the size of this fan fool you! It is powerful, great for a hot summer day, or if your car has no ac, it’s not only a fan it is a flashlight which is very bright, and the topper of all is it’s a phone charger!! For such a small item but packs quite the punch . It is small enough to fit in your purse, pocket or backpack! But don’t let the size fool you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Annie
Belleville, US
★★★★★ 5
Perfect for Summer
Color: Pink
I ordered this portable fan for a trip to the Caribbean and it was perfect. It definitely kept me cool during the heat. It's small and lightweight and it has various settings for different levels of flow. It doesn't oscillate but that's fine with me. I've brought it with me on multiple trips so I'd say it's reliable and it has great power too. The blush pink color is so cute and feminine I love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
F
Verified Purchase
Florence Kuo
Port Orchard, US
★★★★★ 4
Good product with an unexpected flaw
Color: Black
I like this fan. It's compact, easy to use, inexpensive, and kind of cute. The fan is decent. Not insanely strong, not too weak. It's good for its price. But am I the only one who thought the wrist strap was absurdly difficult to pass through the second hole??? It was honestly incredibly frustrating. I tried for five minutes without any tools, and it was impossible due to the combination of the shape and depth of the hollow side of the fan case and the short length of the thin loop on the wrist strap. Perhaps a dexterous child with smaller fingers could do it better. I eventually used a long piece of thread to loop and pull the thin loop back through the second hole. Maybe a paper clip bent into a small hook may work also. I took off 1 whole star for this frustration and struggle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products