SKU: 1818471290

Biotinylated B7-2 Fc&Avi Tag Protein, Human

Sale price$275.40 Regular price$306.00
Save 10%

Pay in installments of $76.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated B7-2 Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen B7 2 Synonyms CD28LG2, B7 2, CD86, B70, LAB72, MGC34413 Accession P42081 Amino Acid Sequence Leu26 Pro247, with C terminal Human IgG1 Fc &Avi tag

Product Specification


Species Human
Antigen B7-2
Synonyms CD28LG2, B7-2, CD86, B70, LAB72, MGC34413
Accession P42081
Amino Acid Sequence

Leu26-Pro247, with C-terminal Human IgG1 Fc &Avi tag

LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight 72-85kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Chia-Lin Chen, Jeffrey Y. Huang, Chun-HsiangWang, Stanley M Tahara, Lin Zhou, Yasuteru Kondo, Joel Schechter, Lishan Su,Michael M C. Lai, Takaji Wakita, François-Loïc Cosset, Jae U Jung & KeigoMachida: Hepatitis C virus has a genetically determined lymphotropism throughco-receptor B7.2, NatureCommunications volume 8, Article number: 13882 (2017).


Background

CD86 is a well-known costimulatory molecule in its interaction with CD28 and/or CTLA present on T cells, and is essential for full activation of naive T-cell and subsequent differentiation. Usually, the B7 molecules are expressed mainly on APCs and B cells and in specific conditions on other activated cells. These costimulatory molecules are involved in the development of allergic inflammation and airways hyperreactivity (AHR) in allergen-challenged mice. Activated T cells, CD4+CD25+, express CD86 in the first 60 minutes after the specific inhalation exposure. These T cells can be relevant in IgE mediated allergic reaction possibly by an autocrine co-stimulation via CD28/CTLA activation pathway. The blockage of the expression of CD86 could be a potential therapeutical target to reduce the magnitude or the progression of the allergic reaction.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1818471290

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Elaine
Belleville, US
★★★★★ 5
Best frother ever!
Color: Flat Black
Super easy to use! Love the 3 speed mode. Makes my morning coffee a breeze to make. Also love the fact that it’s rechargeable. So far only charged once and it’s long lasting. Favor part about it is the storage, doesn’t need to stand straight and be out. Can be easily cleaned and stored away with the cover. Feels very high quality. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
C
Verified Purchase
Chely
Bozeman, US
★★★★★ 5
Compact for travel
Color: Flat Black
Really good, powerful and practical for travel
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
T
Verified Purchase
TLD
Lexington, US
★★★★★ 5
Works Great So Far
Color: Flat Black
I've only used this item for one week. But it is working great. I primarily bought it to use when mixing protein powder, and it has performed great. The only concern that I might share is that it is made fairly lightweight, and I wonder how long it will last. But can, up to this point, recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
J
Verified Purchase
Jay n Debbie (Pillars-Of-Truth)
West Palm Beach, US
★★★★★ 5
Strong, Durable, and SIMPLE Frother
Color: Gray
Excellent frother! It is ‘SIMPLE’, yet very efficient blending. I love that it included a set of long-lasting batteries. The motor on this frother is strong and works great. The item itself is of durable quality. I have had mine for about 9 months and use it daily for my coffee and other drinks throughout my week, and the battery is still running. I even give it a spin after washing the frother spinner/coil. This helps to dry it thoroughly, as the motor is strong enough to blow away any excess water - and still - the batteries are functioning well. The price is just right…very affordable compared to other brands. I’m very pleased with this purchase and absolutely love that it also came with a stand. I display it on my counter everyday. There are 3 solid and Simple colors to choose from, making this an easier shopping experience. Excellent choice for gifting!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
A
Verified Purchase
Avista
Pawtucket, US
★★★★★ 5
Found the perfect chai frother on a budget!
Color: Glossy Black
Okay so I'll be honest, I spent way too long researching milk frothers before pulling the trigger on this one lol. As someone who grew up drinking chai every single day, having a good frother is kind of a big deal in my house. This little thing has been absolutely worth every penny. First off – it's SO easy to use. My 7 year old actually thinks it's the coolest thing ever and wants to help make my morning coffee now, which is honestly adorable. It just works, no fuss, no learning curve. What really sold me compared to other options was the USB-C charging. No more buying AA batteries every few weeks – that stuff adds up! I just plug it into the same charger as my phone. Super convenient. And here's a small thing that matters more than you'd think – it stands on its own! I don't need a separate stand cluttering up my already busy kitchen counter. Build quality feels solid, the stainless steel whisk looks clean and is easy to rinse off. For the price, honestly I expected less. Highly recommend if you're on the fence!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products