SKU: 18299754135

FKBP12 His Tag Protein, Human

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FKBP12 His Tag Protein, HumanProduct Specification Species Human Synonyms FKBP 12, FKBP 1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE Accession P62942 Amino Acid Sequence Met1 Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH Expression System E. coli Molecular Weight 13kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE
Accession P62942
Amino Acid Sequence

Met1-Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH

Expression System E.coli
Molecular Weight

13kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44.

Background

FKBP12 associates with several large protein complexes, including the multi-drug resistance pump and the ryanodine, inositol trisphosphate (IP3)and the type I TGF-β receptor. FKBP12 was originally identifed as a FK506 binding protein. FK506 is a clinically used immunosuppressant derived from Streptomyces tsukubaensis. The FK506–FKBP12 binary complex inhibits the protein phosphatase calcineurin, thereby preventing T lymphocytes from producing interleukin-2 in mammals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18299754135

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
j.dominguez
Lake Worth, US
★★★★★ 5
Reliable Spray for Hard-to-Reach Spots and Reapplication
Size: 5.5 Ounce (Pack of 1)
I picked up this spray specifically to cover the spots I can’t reach with lotion (my back), and it’s been super handy. The spray applies evenly, and while it has a familiar sunscreen scent, it fades quickly. I’ve worked it into my routine for touch-ups, especially on homeward-bound afternoon bike commutes. I keep the can in my bike bag and give everything a quick respray before heading home. It holds up well during activity and gives me solid protection for about two hours, after which I reapply. One thing to note: it does leave a bit of a shiny finish, which is fine for arms and legs, but I skip it on my face during the day because I don’t love the reflective look. That said, if it’s late or I’m not worried about how shiny my face is, it does the job. The SPF 100 is a plus for extended sun exposure, and I like knowing that I’ve got extra coverage when I need it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
K
Verified Purchase
kaylin moss
Lake Worth, US
★★★★★ 5
good protection
Size: 5.5 Ounce (Pack of 1)
it works well as long as you let it dry. i’d not it gets sticky and gross and then peels off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2024
J
Verified Purchase
Jazmin
Lake Worth, US
★★★★★ 5
Protected my kids through 7 hours of sun and water—no burns at all!
Size: 5.5 Ounce (Pack of 1)
This sunscreen is the real deal. We spent a full day, about 6 to 7 hours, at a water park under the blazing sun. My kids were running around nonstop, in and out of the water, and we reapplied every 30-45 minutes. Not a single sunburn. Their skin looked exactly the same by the end of the day, no redness, no irritation. Meanwhile, I skipped sunscreen and got absolutely fried. Lesson learned. Goes on smoothly, doesn’t leave a sticky residue, and held up amazingly even with water play. I’ll be buying this on repeat all summer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2025
S
Verified Purchase
Sophia Velasquez
Boise, US
★★★★★ 4
Smells great. Tough to remove.
Size: 5.5 Ounce (Pack of 1)
The smell is great and very nostalgic, but it has a sticky/tacky feel on the skin. It's hard to get off even with a lot of scrubbing with soap and hot water. They weren't joking that it stays on through water and sweat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2024
D
Verified Purchase
Dr. Kenneth A. Merena
Phoenix, US
★★★★★ 5
A TERRIFIC FIND FOR US IN ECUADOR
Size: 5.5 Ounce (Pack of 1)
Here in Ecuador, this product isn't even available to us. I have the most precious 20 month old girl living with us and of course I wanted to get a quality product at less cost. This fits the bill. With an SPF 100 rating from a decades old and trusted manufacturer and a price that is less than one third of what I would have to pay for any sort of water resistant equivalent, this was a no brainer. If you buy this product, please read the instructions and follow them. It is a spray product that great care should be used to avoid spraying directly on the face--------- either your own or the child's. Spray it on your hand and apply it to any face that needs it. It's convenient for neck, shoulders, backs and legs due to its spray delivery. Our little 20 month old must be part fish because she loves the thermal pools we take her to and this product seems quite durable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2024

recommand products