SKU: 1847941004

Human Plasminogen, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plasminogen, His tagProduct Specification Species Human Synonyms PLG Accession P00747 Amino Acid Sequence Protein sequence(P00747, Asn79 Pro466, with C 10*His)

Product Specification


Species Human
Synonyms PLG
Accession P00747
Amino Acid Sequence

Protein sequence(P00747, Asn79-Pro466, with C-10*His) NRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:45.7kDa Actual:65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plasminogen (former name profibrinolysin) is an inactive precursor of plasmin. It is a plasma protein that is part of the fibrinolytic system. Plasmin is an important enzyme (EC 3.4.21.7) present in blood that degrades many blood plasma proteins, including fibrin clots. In circulation, plasminogen adopts a closed, activation-resistant conformation. Upon binding to clots, or to the cell surface, plasminogen adopts an open form that can be converted into active plasmin by a variety of enzymes, including tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). Plasmin deficiency may lead to thrombosis, as the clots are not adequately degraded. Plasminogen deficiency in mice leads to defective liver repair, defective wound healing, reproductive abnormalities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1847941004

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kanwal Mansoor
Los Angeles, US
★★★★★ 5
Fitting it good!
Color: Army Green, Size: X-Large, Color: Army Green, Size: X-Large
My husband loved it. Looks a little different when u took the pic but it’s the same color as the ad photo For reference my husbands 5’11 and 225lbs totally recommend and it’s cotton.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
W
Verified Purchase
Will Smith
Houston, US
★★★★★ 5
Good Product
Color: White, Size: XX-Large
Good Product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
C
Charlie P
Lake Worth, US
★★★★★ 4
Comfortable and good value
Color: Black, Size: XX-Large
The material of this cotton/linen blend kaftan is light and breathable. The sleeves are just the right length for me. The fit around my chest is a bit tight, but still it’s comfortable to wear so long as I don’t reach up for something. FYI, I have a 52-inch chest and ordered a size XXL (the largest available); this should allow others to judge how the size runs. I wore it to dinner with some Moroccan co-workers who dressed in similar garments; they were impressed, and complimented on how nice it looked on me. I told them that one day I’d surprise them with such a garment, and I definitely did just that. The lower 2 buttons work great, but the one around the collar has a very tight loop which makes it difficult to button and unbutton. I can’t use that button anyway because the collar is too small for my neck. The craftsmanship is top notch according to my friends. I didn’t mention that I got this for free, and let them know the Amazon price. They agreed with me that this was a good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
M
Verified Purchase
Mr. SUCCESSFUL CEO
Alexandria, US
★★★★★ 5
Throbe
Color: Black, Size: X-Large
Good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
W
"WE WINN!!!"
Birmingham, US
★★★★★ 5
For the L*ve of the Game...
Color: Black, Size: XX-Large, Color: Black, Size: XX-Large
When I ordered this beautiful Thobe I noticed along with its minimalistic nature in looks that it took on, was the low price point... these dress garments usually run me a pretty penny in pastimes. It is soft, breathable & comfortable with a slender-like fit, all while being made of cotton and linen, which can be worn in multiple seasons... I ordered the black for a test run, and I am always on the look-out for (linen-cotton) around the clock (seasons)! And I am very pleased to report that I need additional colors because the quality of this garment is off the hook... and I want them all on MY hook! "WE WINN"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products