SKU: 19054634386

Human Lambda, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lambda, His tagProduct Specification Species Human Accession P0CG04 Amino Acid Sequence Protein sequence(P0CG04, Gly1 Ser106, with C 10*His) GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 13kDa Actual: 17kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Accession P0CG04
Amino Acid Sequence

Protein sequence(P0CG04, Gly1-Ser106, with C-10*His)
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13kDa Actual: 17kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). There are two types of light chain in humans: kappa (κ) chain and lambda (λ) chain. Individual B-cells in lymphoid tissue possess either kappa or lambda light chains, but never both together. Specific rearrangement of lambda light chain of immunoglobulins can lead to loss of some protein coding genes. Using immunohistochemistry, it is possible to determine the relative abundance of B-cells expressing kappa and lambda light chains. If the lymph node or similar tissue is reactive, or otherwise benign, it should possess a mixture of kappa positive and lambda positive cells. If, however, one type of light chain is significantly more common than the other, the cells are likely all derived from a small clonal population, which may indicate a malignant condition, such as B-cell lymphoma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19054634386

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael Lucas
Omaha, US
★★★★★ 4
Decent Quality, Will Buy Again
Package Size Name: Double, Size: 6 Double Rolls (Pack of 1)
I recently picked up the Sparkle Pick-A-Size Paper Towels (6 pack) and overall I’m pretty happy with them. The pick-a-size feature is really convenient because you can tear off a smaller sheet for quick spills instead of wasting a full one. For everyday kitchen messes—wiping counters, small spills, or drying hands—they work perfectly well. They’re also reasonably absorbent and the rolls seem to last a decent amount of time, especially when using the smaller sheet sizes. For the price, it feels like a good value compared to some of the more expensive brands. The reason I’m giving 4 stars instead of 5 is that they’re not quite as thick or strong as the premium paper towels out there. For bigger or really messy cleanups, I sometimes end up using two sheets. Overall though, these are a solid everyday paper towel that get the job done and help reduce waste with the pick-a-size option. I’d definitely buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
R
Verified Purchase
Roberta
Grantham, US
★★★★★ 5
Really impressed with the quality and absorption
Package Size Name: Double, Size: 12 Double Rolls (Pack of 1), Package Size Name: Double, Size: 12 Double Rolls (Pack of 1)
I’ve been using these Sparkle paper towels for a few days now, mostly in my kitchen, and I’m honestly impressed. The absorption is great, it handles spills like coffee or oil without needing a bunch of sheets. I also love the “tear-a-square” feature because you can use just what you need and avoid waste. They’re pretty strong too, don’t fall apart easily while cleaning, which makes a big difference for tougher messes. So far, totally worth it and I would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
A
Verified Purchase
Amy Biggs
Lake Worth, US
★★★★★ 5
Lifesaver for a Single mom With Kids and Constant Messes
Package Size Name: Double, Size: 24 Double Rolls (Pack of 1), Package Size Name: Double, Size: 24 Double Rolls (Pack of 1)
What I Expected: I honestly expected these to be just another basic paper towel that looked good in the listing but ran out fast, fell apart, or left a lot of lint the second my kids spilled something. The listing made them seem thick, strong, and a good value for a busy household. What I Got: After using them for a few weeks, I can say they have been a literal lifesaver. Between two kids, muddy shoes, spilled juice in the truck, quick cleanups in the garage, and wiping down the RV before a trip, these have held up way better than I expected. I’ve noticed minimal shrinkage after wet use, and they rarely leave any lint behind, which is a huge plus for cleaning everything from countertops to tools. What I Like: The pick-a-size sheets are great because I do not waste a full sheet for a small mess, and the towels are strong enough that I usually only need one. They are soft enough for everyday kitchen use but still durable when cleaning greasy tools or bigger messes. Quick tip for buyers: keep an extra roll in the truck or RV because they come in handy more than you think. What I Don’t Like: The only downside is that the rolls are large and take up a little more storage space. Final Verdict: Great for families, busy parents, garages, trucks, or RVs. Minimal shrinkage, low lint, and super durable—I will definitely buy these again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
S
Verified Purchase
Shopper59
Waukegan, US
★★★★★ 5
Sparkle Pick-A-Size
Package Size Name: Double, Size: 24 Double Rolls (Pack of 1)
These are not large rolls. I can't say if they are lint free or not. I only use them for spills or to dry my hands. The price is right and they do the job we need. These are satisfactory paper towels for my house. I will buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
J
Verified Purchase
Joshua
Houston, US
★★★★★ 5
The ultimate water bottle
Color: Iced Breeze, Size: 24 Ounces
I can’t believe I’m so excited about a water bottle. The design is amazing - I love that there’s no straw poking up but there’s still a straw sip function. I like that the carrying hook doubles as a lid locking mechanism. This bottle feels very sturdy but it’s sleek and easy to grab - I have small hands and it isn’t a problem for me to drink from with one hand. It’s also really nice that this bottle fits in standard couple holders both at the gym in the machines and in my car. The color selection is so fun and I am pleased that my bottle looks exactly as pictured. My water has stayed cold and my ice cubes frozen for over 12 hours now. Cannot recommend enough!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products