SKU: 19464940905

TIGIT His Tag Protein, Cynomolgus

Sale price$202.50 Regular price$225.00
Save 10%

Pay in installments of $56.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIGIT His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Amino Acid Sequence Met22 Pro142, with C terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity >90% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Amino Acid Sequence Met22-Pro142, with C-terminal 6*His MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPGGGSGGGSHHHHHH
Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>90% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell immunoreceptor with Ig and ITIM domains (TIGIT), also known as VSIG9, VSTM3, and WUCAM, is a member of the poliovirus receptor family of immunoglobulin proteins. TIGIT is expressed at low levels on subsets of T cells and NK cells, and is upregulated at the protein level following activation of these cells. TIGIT marks exhausted T cells in the tumor microenvironment and during human immunodeficiency virus (HIV) infection. Research has shown TIGIT interacts with several receptors expressed on antigen presenting cells, such as dendritic cells and macrophages, as well as tumor cells and cells of the microenvironment. TIGIT binds with high affinity to PVR/CD155, and with low affinity to Nectin-2/CD112 and Nectin-3/CD113. Upon binding to its ligands, TIGIT suppresses T cell activation, and inhibits T and NK cell cytotoxicity. This inhibition can be blocked using monoclonal antibodies directed at the extracellular domain of TIGIT, resulting in rejuvenated antigen-specific CD8+ T cell responses in tumors and during HIV infection. Three potential isoforms of TIGIT have been computationally mapped.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19464940905

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Elizabeth
Battle Creek, US
★★★★★ 5
Replacement stickers are on the way!!
Color: silver, Color: silver
Edit: Customer service was lovely and I have replacement stickers on the way. This fabulous product has helped me so much and I can't be without it. Back up to a 5 star review. I purchased this product in April 2024. The stickers that help the laptop 'grab' onto the stand are either gone or unstable. See picture below. Can it be repaired with new stickers? How do I get them?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
P
Verified Purchase
ProudPapa
Dallas, US
★★★★★ 5
Sixty Bucks? Yep. And I'd buy another one.
Color: silver
OK, I had my doubts. Yes, the iLevel2 is highly-reviewed. And yes, it's really (really) important to have your laptop screen at eye level (get it? iLevel?) But spending 60 dollars on an adjustable laptop stand? Couldn't I just pile up a couple of old books for free? Well, as a contractor once told me when I made a really dumb suggestion, "You COULD do it that way..." The iLevel2's main virtue is that the angle/height adjustment knob is rock-solid, as is the platform. It's just an extremely well-made, solid product. And the adjustment knob, which is on a left-right track on the front of the product, allows you to dial in your laptop's screen height to the millimeter. Result: a totally-custom, ergonomically-friendly setup. Love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 13, 2024
R
Verified Purchase
Russ
Grantham, US
★★★★★ 3
Underwhelming
Color: silver
Too much hype. It just holds the laptop. Buy something cheaper. The slide adjuster isn’t useful to me at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
B
Verified Purchase
beth
Natrona Heights, US
★★★★★ 5
Useful but not perfect
Color: silver
Useful, but typing with laptop perched on it is unsteady. I use a separate keyboard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
V
Verified Purchase
vics
Alexandria, US
★★★★★ 5
Why are people trying to type on a laptop stand?
Color: silver
So the overwhelmingly negative reviews you'll notice for this product specifically surround the "bounciness" of this stand when someone is typing on it—however what is confusing to me is how people are purchasing a laptop stand in theory to optimize their ergonomics, yet also stretching their arms out and elevating them to type on said laptop once it's raised. the point of a laptop riser/stand is to elevate the screen so that you can maintain a more natural posture. One would assume you have an external keyboard to use in conjunction with your laptop once you place it on a RISER, because the idea is to elevate your laptop as a SCREEN and then have a level/flat surface to type on, thereby alleviating any awkward hunching or neck strain looking down or anywhere not naturally eye-level. as it is, it's a perfectly functional and elegant laptop riser. I don't find myself wanting to adjust the height often if ever, but in the one or two instances I experimented with it, found no mechanical issues. It looks nice with Apple hardware and allows me to have my laptop's screen flush with the bottom edge of my additional external monitor, so it serves my purposes well. for people complaining about how it bounces when they type on it ... STOP typing on your laptop's keyboard when you have it elevated on a riser! this defeats the purpose and probably also makes your arms tired—buy an external keyboard!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2020

recommand products