SKU: 19662647457

Ephrin-A3 Fc Chimera Protein, Human

Sale price$176.40 Regular price$196.00
Save 10%

Pay in installments of $49.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin-A3 Fc Chimera Protein, HumanProduct Specification Species Human Accession P52797 Amino Acid Sequence Gln23 Ser213, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P52797
Amino Acid Sequence

Gln23-Ser213, with C-terminal Human IgG Fc

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-70kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Eph receptors compose the largest family of receptor tyrosine kinases (RTKs), which are capable of recognizing signals from the cell environment and influencing cell-cell interaction and cell migration. Ephrins are the ligands to Eph receptors and they stimulate bi-directional signaling of the Eph-ephrin axis. Ephrin-A3 (EFNA3) is one of the ephrin ligands which could bind to EphA2, EphA3, EphA5, EphA7, EphA8 and more poorly to EphA4. It is not only expressed in skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine and peripheral blood leukocytes, but is also present in neuroblastomas, neural cancers and leukemias. The dysregulated expression of EFNA3 has been observed in many types of human cancer. The expression level of EFNA3 was found to be upregulated 26-fold in squamous cell lung carcinoma, 3.8-fold in liver cancer, 1.6-fold in colon cancer and downregulated 2.6-fold in kidney carcinoma, respectively.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19662647457

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
U
Verified Purchase
Urban Professor
Grantham, US
★★★★★ 5
Slave Trade was not only a White Man's Affair
Format: Kindle
The book is an excellent read particularly in today's climate. Why 53% of white women would put a vile man in office is explained in the pages of this book. White women held positions of power in the America slave trade, a fact overlooked in history. These southern bell's represented as the gold standard of woman hood in the antebellum south were anything but, and they for the most part showed as much, business savvy as down right cruelty in the slave trade. They benefited in every conceivable way from this free labor market. They were no advocates for the kind humane treatment of slaves. In many cases they were as vicious as their counterpart and just as committed to a keeping Blacks marred in the system of bondage. They are in most cases depicted as silent partners and where that might be the case many white women had full command and knowledge of the value of a slave they invested in and they wanted a hefty return. In fact they used every means on the table to keep these black, men, women and children bound to their wealth creation. These co-conspirators had more than a hand in the cookie jar, they enjoyed the power and did not hesitate to support the maintenance of this inhumane institution.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2019
T
Verified Purchase
The Gypsy Reader
Whiting, US
★★★★★ 5
Excellent book, not only for lawyers or law students
To begin with, I am neither a lawyer, a law student, nor even a prospective law student. I am, however, someone who has always been interested in the law, primarily for two reasons. First, the law is the principal formal means a society uses to try to resolve conflict among the society's members. Second, and closely related to the first reason, the sum shape, both of content and procedure of the law, is an expression of exactly what a society's values are and the goals a society sets for itself or the standards by which it ideally wishes to be judged. I found this book to be excellent, informative, well written, and even at parts entertaining. Although meant as a guide for law students to use to prepare for the strenuous exams that are associated with each course they will take in law school, the book provides much, much more, and hence my belief that it can profitably be read by a far larger readership than its ostensible audience. One of the key elements stressed throughout, and exemplified by numerous enlightening examples, is that there usually is no one correct answer to any given legal question. Arguments can be made on at least two sides of any matter based upon, for example, a "plain reading" of the text of a relevant law and the reasonably understandable intent of those who made the law (e.g., a legislature). The authors bring out clearly such sources of legal precedent as laws, government regulations, individual case law decisions by judges, common law, government policy, and specific codes (e.g., the Uniform Commercial Code, or UCC) and show how differing results to a case can readily come about based upon arguments using the different sources to bolster respective cases. In reality, although by minimal definition a book designed, as said above, to prepare for the taking of law school tests, the book actually also is a good guideline on how to think (not necessarily what to think) about many larger issues in society, including politics and policy issues of all sorts. Finally, the first two thirds of the book discuss ways to think about the wide range of questions that can be posed to aspiring lawyers and introduces the reader to understanding such distinctions as "forks in the law" and "forks in the facts" (a quite useful distinction to keep in mind). The final part of the book provides solid test taking strategies that are applicable to a wide range of academic testing (e.g., answer the question the professor actually asked and avoid wasting time or effort on ancillary matters not really germane to helping to resolve the issue.) Although some of these may seem obvious once read, the tips are the type of thing that, under pressure of exams, many students often forget to apply. In sum, I highly recommend this book to those interested in life in the modern world.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2015
A
Verified Purchase
Amazon User
Waukegan, US
★★★★★ 5
Must read for 1L or Incoming Law Student! So helpful!!!
Format: Paperback
Any 1L or incoming law student needs to read this book! So, I took the BARBI Law Preview before law school began to get an overview of what law school was like and a heads up on how to do things. During this program I had read just two chapters of the book- and these two chapters alone put me in a crucial mind frame to understand the importance of what your professors are looking for. It is not just about distinguishing the right issues and facts, because there is truly no such thing, but distinguishing both sides of an issue, and of course you have to read the book to get more info, but I feel like it has helped me understand what success sounds like in exams. I am only going into my third week of 1L, but I can tell the book has given me a leg up. I recommend that you read this book before you start, or in the first two weeks (though you'll be burdened with a lot of reading then- so before is best) so you can get into the mindset, instead of doing it right before exams and feeling like you have to rewire your brain to everything you thought you understood. I guess I'll have to update you guys once I see my exams, but so far so good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2015
I
Verified Purchase
Ingersoll1969
Boise, US
★★★★★ 4
Must-Have for Law Students
Format: Paperback
This is a good book. A lot of the trouble with law school exams is law professors are notoriously bad teachers, and these bad teachers write bad exams. Granted, this is a worst-case scenario, but if you've been to law school for more than one semester, there's a good chance that at least one of your professors has utterly bamboozled you into how he/she wants the final written. So what this book does is give you something of a blueprint and a method of examining fact patterns and exploring the question(s) so that you can simply go into the exam and take it without much fear. Where the book fails to be of help though, is with the IRAC method. I wholeheartedly agree that IRAC is a too-constrictive method of writing that tends to inhibit most students from really expressing what they know. Law professors largely want a mechanical recitation of rules followed by mechanical analysis, so law students spend hours and hours memorizing rules with the ultimate purpose of using them in an IRAC format. It's absurd, but that's the way it is. And this book simply dismisses the fact that lazy law professors love IRAC for the fact that it gives them a template from which they can read and score exams quickly. But still, you can construct an IRAC using this method, it just doesn't lend itself seamlessly to it, which is pathetic--not with respect to GTM, but to the teaching and testing methods used by professors. If you don't believe me, and if you haven't already done so, go look at model bar answers from your state and see if they employ a rigid IRAC formula. They don't. And so to me, that's what this book was good for--being able to write bar exam quality answers that leave room for a different writing styles and methods of analysis. If you're just starting law school, buy this book. If you're already in and still struggling, buy this book. If you're the king or queen of fastidious, multiple, anally retentive headers on your exams, read this book and go look at bar answers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 22, 2016
A
Verified Purchase
autofila
Waukegan, US
★★★★★ 5
The ONLY MARKET-AVAILABLE "ISSUE-IDENTIFICATION" book!!!
Format: Paperback
I purchased it twice: the first time in the law school, but I had misplaced it in the school library & lost it. The second time: while preparing for a BAR exam, I have realized that I material, but I was still missing issues. The book helped. Also, I did not get it on my first read & deeply dissatisfied. But, upon reading the second time & reading it later, I have gotten the point completely. The book helps to formulate what the issues are & you have to understand how to "uncover" the issues prior to formulating the issues. The book helped again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 15, 2024

recommand products