SKU: 19672969472

Monkeypox virus A29L, His Tag

$135.00 $150.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A29L, His TagProduct Specification Species MPXV Synonyms A29L, Mpox, Monkeypox Accession Q9YN60 Amino Acid Sequence Protein sequence(Q9YN60, Met1 Glu110 with C 10*His) MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 2kDa Actual: 16 23kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species MPXV
Synonyms A29L, Mpox, Monkeypox
Accession Q9YN60
Amino Acid Sequence

Protein sequence(Q9YN60, Met1-Glu110 with C-10*His)


MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical: 14.2kDa Actual: 16-23kDa
Purity

＞95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19672969472

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
eduardo valdes
West Palm Beach, US
★★★★★ 5
Great, simple and reliable.
Color: Green/Green/Natural
It's a great watch sad I had to return it because it was a little too small for me. I have very large wrist
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
J
Verified Purchase
John H.
Charlottesville, US
★★★★★ 1
Bought a "Used like new" watch. Doesn't keep time
Color: Black/Black/Black/Fast-Wrap
I've had this for a few weeks. Since then, it's lost about 30 seconds. I'm not sure if it's this specific unit that has the issue or the mechanism itself. It's a shame because it's a killer looking watch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Verified Purchase
John
Omaha, US
★★★★★ 5
Another Great Timex !
Color: Brown/Brown/Natural, Color: Brown/Brown/Natural
Great beater watch. Lime on hands glows for 15 mins. Indigo is brite. Legibility is great. Fits small wrist well. Great watch!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
H
Verified Purchase
HikerBiker
Pawtucket, US
★★★★★ 3
Light, retro watch
Color: Brown/Brown/Natural
This is a light, comfortable and retro-stylish watch. A mixture of plastic, canvas, and faux-leather makes a good match for a college professor's tweed jacket with leather shoulders and elbow patches. It looks and feels cheap but it's actually a pretty good watch. Mine has a high contrast face making it easy to read. The hands have lume on them but it only glows for a few minutes. There is an indiglo feature when you press the winder so that's great. The day window is tiny and almost unreadable even with reading classes but other than that it is very functional. You can adjust the time and day independently (so you don't have to wind through 100+ hours to get the right day displayed). The winder setting to select between time and day adjust is very finicky. Fortunately you only need to adjust the day 5 times a year. The weakest part is the build quality. I'm not expecting Rolex, but the case corrodes really badly and the strap is short and the stitching failed so it fell off my wrist in about 6 months. I replaced the strap with a better one but the case corroded so badly I tossed it within a year. Other than looking cheap, poor build quality, and being thicker than I would like, I think this is a good watch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 17, 2025
I
Verified Purchase
Irish Wolfhound NYC
Boise, US
★★★★★ 5
A nice, comfortable watch.
Color: Black/ Green
A nice inexpensive everyday watch. It is accurate, a nice size for my wrists. You barely feel it as it is so light. it has a nice clear face Andy only gripe is that I wished it had slightly better loom. Other than that it is a great watch for the money and this is coming from someone with 30+ watches in my collection in all price ranges. It has earned its way into my regular watch rotation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 14, 2025

recommand products

Vase in Antique Silver
128.75
Weymouth Eco-Performance Posi-Temp Tub and Shower Trim - Brushed Gold TS32104EPBG Moen
486.49
Mirror in Silver
141.56
Sculpture in Raw Nickel
55.00
Etagere in Galvanized Metal And Brown
165.31