SKU: 199256381

Human CD81, His Tag

Sale price$119.25 Regular price$132.50
Save 10%

Pay in installments of $33.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD81, His TagProduct Specification Species Human Synonyms 26 kDa cell surface protein TAPA 1, Target of the antiproliferative antibody 1, Tetraspanin 28 (Tspan 28) Accession P60033 Amino Acid Sequence Protein sequence(P60033, Phe113 Lys201, with C 10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 4kDa Actual: 11kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28)
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His)


FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.4kDa Actual:11kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70℃ as supplied.

1 month, 2 to 8℃ under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 199256381

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dot
Birmingham, US
★★★★★ 5
So far this is the perfect alternative to other wobble toy feeders. Please make a bigger size!
Size: 1 Pack, Style: Pawbler
Why did you pick this product vs others?: I bought the Pawbler because the two most popular wobble treat feeders on the market are plastic, and one of my dogs just absolutely destroys those in no time because he bites them and throws them rather then nudging them and then he has plastic cutting him so I am forced to throw away a costly treat toy/dispenser. I thought maybe a rubber one would work out better. So far my dogs love it, it works well spitting out their kibble, seems to be holding up and is easy to clean and feels like a good weight, not a super flimsy toy. I would love to see it made in a slightly larger size, I think this current size is good for medium dogs. It holds just under a cup of small round kibble but I would like to see one that can hold more and is slightly larger in size. I have 4 german shorthaired pointers, my test subject for this toy is mostly my 70 pounder who bites the toys instead of nudging them and throws them across the room, so it is taking a beating. I think for him a larger size would be helpful in deterring that behavior but I also think this may be too small for larger breeds. Durability: So far this toy looks just like when I bought it. It has no punctures or scratches and unscrews without problem. We have only had it a week or so but we use puzzle/toy feeders to feed our dogs lunch every day so it is pretty easy to tell which toys won't last long. Obviously, I can't speak to long-term durability at the moment, but I can say that most toys similar to this end up already scratched or punctured in a few days, so this is already sturdier when compared to what I have tried before.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
E
Verified Purchase
EMarie
Lexington, US
★★★★★ 4
Well made and durable, not a toy the pups seek out
Size: 1 Pack, Style: Tug
Well made. Thought our staffies would love since they live tugging with each other. Sadly not something they seek out. We love ALL the benebone chews though!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
S
Verified Purchase
Srp
Lexington, US
★★★★★ 5
Durable fun enrichment toy
Size: 1 Pack, Style: Pawbler
I had been wanting to buy one of these kinds of toys for some time but thought that the other brands I had seen were too pricey so this was a great compromise for the price. My 5 yr old Portuguese water dog loves it. He spent 25 min playing with it the first day. The trick is to find a treat that is just big enough where it doesn’t fall out right away so it makes it challenging and fun for them. He has been chewing on it a lot for a week and it has not broken or shown signs of damage. One thing to note is that there is a small hole on the bottom of the toy so you cannot freeze liquids in it without covering the hole in some way so that would be my only complaint. Besides that it’s a great toy that keeps him busy and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
M
Verified Purchase
Myles Long
Lake Worth, US
★★★★★ 3
Dog doesn’t care for it
Size: 1 Pack, Style: Bone
Hard to review product for its durability because my dog has never chewed it once. Doesn’t care about it at all. The bone feels rugged but smells like playdoh. It’s sat on the floor for over a month untouched.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Sunshine89436
Birmingham, US
★★★★★ 1
Pawbler FAIL: First time our dog bit the ball, it popped open and dumped all the kibble.
Size: 1 Pack, Style: Pawbler
I would not recommend! We have a 48# dog and within minutes of giving it to him, the Pawbler was open and all of the kibble was in a pile on the ground. I had washed and dried the Pawbler, added kibble, and tightened the lid as tight as possible. Imagine my surprise when, within minutes of giving it to him, the lid was off and all the kibble was on the ground. I thought it was a fluke so then I made an extra effort to make sure the lid was super tight...and the same thing happened. This time there was no food inside so he started chewing on the two parts. Within minutes of that, he'd chewed/damaged the rubber on both the body and the lid. I took it away as I didn't want him to destroy/eat any of the rubber bits. I was surprised he could even get the Pawbler in his mouth. It's heavy and he is a medium sized dog. He has the Benebone Bone, the WestPaw bone, the WestPaw ring that he chews on all of the time and none of those are showing any type of wear so to see this opened/chewed within 15 minutes makes me think this was defective. I am returning and hoping for a refund. DO NOT BUY! Poor value for the money. Not durable. Not chew resistant.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products