SKU: 20220313850

Human AAT, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human AAT, His tagProduct Specification Species Human Synonyms Alpha 1 protease inhibitor, Alpha 1 antiproteinase, Serpin A1, AAT, PI Accession P01009 Amino Acid Sequence Protein sequence (P01009, Glu25 Lys418, with C 10*His)

Product Specification


Species Human
Synonyms Alpha-1 protease inhibitor, Alpha-1-antiproteinase, Serpin A1, AAT, PI
Accession P01009
Amino Acid Sequence

Protein sequence (P01009, Glu25-Lys418, with C-10*His) EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 46.0 kDa Observed MW: 55-70 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Alpha-1 antitrypsin or α1-antitrypsin (A1AT, α1AT, A1A, or AAT) is a protein belonging to the serpin superfamily. As a type of enzyme inhibitor, it protects tissues from enzymes of inflammatory cells, especially neutrophil elastase, and has a reference range in blood of 0.9–2.3 g/L, but the concentration can rise manyfold upon acute inflammation. When the blood contains inadequate amounts of A1AT or functionally defective A1AT (such as in alpha-1 antitrypsin deficiency), neutrophil elastase is excessively free to break down elastin, degrading the elasticity of the lungs, which results in respiratory complications. A1PI also acts to induce locomotion of lymphocytes through tissue including immature T cells through the thymus where immature T cells mature to become immunocompetent T cells that are released into tissue to elevate immune responsiveness.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20220313850

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jumpskippy
San Leandro, US
★★★★★ 5
Amazing!! Redness and itchiness gone after 1 day!
Size: 6.76 Ounce (Pack of 1), Size: 6.76 Ounce (Pack of 1)
So, I've had really bad rashes around my eyes and cheeks for a few years. The doctors can't tell me what it is but just used to prescribe me steroid cream which thinned my skin and gave me eye wrinkles. I read about this in a post on Pinterest and ordered it immediately as I had a recurring rash on my face for 3 weeks that kept coming back. Yes it's $32 but I was DESPERATE. Everything else I tried burned my face, even products with the eczema association seal! I was so excited when this came in the mail. I was tiding myself over with Clinique's Dramatically Different Moisturizing Cream and yes, it hydrated my dry face but it stung on contact a bit, and also made my skin tight and began to peel, not painfully but still gross. So I finally got a chance to put this xeracalm product on my face last night. I put about a quarter size amount at first, then two extra pea sized amounts under my eyes. Unfortunately through the night my face soaked it all up (my skin is EXTREMELY DRY and it's winter now) but as soon as I woke up and look in the mirror my redness was 90% gone. My face was a little tight but not uncomfortably, and definitely no peeling. It also does not burn on contact which is so great for me. It's called a balm but it's really more like a heavy thick cream. The top is interesting as you just squeeze it and it pops out and dispenses product to not contaminate it. If you have a problem with the dispenser you have to be an idiot, I just have to be honest lol. It's not rocket science. It serves a very important purpose. Also, I was surprised at the size. $32 seemed pricey but for the amount of product I got it is totally appropriate. I only see myself using this for when my skin gets REALLY DRY and not for regular use though. And a little goes a long way. I'm hoping to see my face go back to normal in a few days. I will definitely update!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2016
S
Verified Purchase
Sariah
Waukegan, US
★★★★★ 5
This is SO helpful for Dyshidrotic Dermantitis
Size: 6.76 Ounce (Pack of 1)
I have dyshidrotic dermatitis and this helps me with the dryness and itchy feet. It is pretty greasy but I have to keep socks on so I don't care. It works the best if you use it twice a day but still works well once a day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
M
Verified Purchase
Mimi D.
Phoenix, US
★★★★★ 5
A rich moisturizer that doesn’t feel heavy!
Size: 13.5 Ounce (Pack of 1)
I bought this because the skin on my face is very reactive and has also been very dry and I wanted to try something that was a little more rich than the moisturizer I was using. I liked that this is for face and body so it comes in a bigger size than typical face moisturizers come in. I have been using it for about a week and have noticed a reduction in flakiness and my sensitive skin does not get irritated by it. It absorbs really well and doesn’t feel heavy or make my skin feel sticky. I definitely feel it is worth the price since you get so much in the bottle and it will last a very long time!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
V
Verified Purchase
Verified User
Los Angeles, US
★★★★★ 5
The best eczema cream I’ve used !!!
Size: 6.76 Ounce (Pack of 1)
I will give 10 stars if it were available!! Used most of the eczema creams out there, including prescribed ointments, but given the fact you can’t avoid using water on your hands throughout the day, the eczema was only getting worse for the past couple of months! I am glad I didn’t give up and found this cream!!! The second I put this cream on my hands, it immediately moisturized the itching and flaking skin without drying or being greasy unlike other creams I’ve used before. It’s very calming, soothing, and deeply moisturizing! So I had to write this review for those who are suffering the similar symptoms. This may help you as much as it is helping me as I speak!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
M
Verified Purchase
Megan
Port Orchard, US
★★★★★ 4
Seems to work for damaged barrier (accidental damage as well as eczema and rosacea).
Size: 6.76 Ounce (Pack of 1)
SO I am currently tryign to repair a damaged skin barrier. I have both rosacea and eczema so it's nearly impossible to find a product that makes both conditions happy. I started out using the cream version of this but my face always felt dry with it. I decided to try this since a balm usually helps keep in moisture much better. I am only using a gentle cleanser and this, planning on adding in a toner at some point. At first I thought I was sent the cream again because this comes out like their cream version but as you rub it to spread, you can tell it has a thicker feel to it. It spreads easily and doesn't tug at my skin. Seems to sink in pretty quickly but it does leave a sticky film until it completely absorbs. I can feel my eyelids stick while waiting. Not sure how long it takes to fully absorb because once it does on my eyelids, I forget. But the stickiness does go away and leaves a soft texture behind. I do find some itching in places I normally get when my skin dislikes an ingredient. But I'm not sure if it's my normal or current damaged barrier. It helps with the dry feeling and I would say I only feel a slight tightness. But so far, the best moisturizer I have used. And I love that there is NO NIACINAMIDE, NO HYALURONIC ACID, no oat, no shea butter, and no cica/centella asiatica. These ingredients wreak havoc on my skin and everybody is adding this to everything. It's been so hard to find a moisturizer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 18, 2025

recommand products