Pay in installments of $77.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
XIAP(Bir3) His Tag Protein, HumanProduct Specification Species Human Antigen XIAP(Bir3) Synonyms XIAP, API3, BIRC4, hIAP 3, hIAP3, IAP 3, ILP1, MIHA, XLP2 Accession P98170 Amino Acid Sequence Asn252 Thr356, with N terminal 6*His MHHHHHHNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT Expression System E. coli Molecular Weight 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Antigen | XIAP(Bir3) |
| Synonyms | XIAP, API3, BIRC4, hIAP-3, hIAP3, IAP-3, ILP1, MIHA, XLP2 |
| Accession | P98170 |
| Amino Acid Sequence | Asn252-Thr356, with N-terminal 6*His
MHHHHHHNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT |
| Expression System | E.coli |
| Molecular Weight | 13kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Holcik M. et al. (2000) Functional Characterization of the X-Linked Inhibitor of Apoptosis (XIAP) Internal Ribosome Entry Site Element: Role of La Autoantigen in XIAP Translation. Mol Cell Biol. 20(13): 4648-57. 2、Winsauer G. et al. (2008) XIAP regulates bi-phasic NF-kappaB induction involving physical interaction and ubiquitination of MEKK2. Cell Signal. 20(11): 2107-12. 3、Suzuki Y. et al. (2001) X-linked inhibitor of apoptosis protein (XIAP) inhibits caspase-3 and -7 in distinct modes. J Biol Chem. 276(29): 27058-63. |
Background
XIAP is a direct inhibitor of caspase-3 and -7, and suppresses the mitochondrial apoptotic pathway by inhibiting caspase-9. XIAPs comprised of 6 exons that encode XIAP, a 497 amino-acid protein whose functions include regulation of apoptosis and promotion of intracellular signaling during innate immunity. Currently, approximately 25 distinct XIAP mutations have been reported in patients with XIAP deficiency. Mutations reduce XIAP expression in half to two-thirds of patients, but missense mutations and C-terminal nonsense mutations or deletions allow for varying levels of expression of mutant protein. As is the case with SAP deficiency, female XIAP mutation carriers are asymptomatic. However, unlike SH2D1A carriers, XIAP carriers typically demonstrate skewed lyonization in lymphocytes in favor of cells retaining wild-type XIAP expression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy