Pay in installments of $45.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
For Your Every Summer RSVP, with Code: SUMMER15
Description
PD-L1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Programmed Cell Death 1 Ligand 1, PD L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7 H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1 Accession Q9NZQ7 Amino Acid Sequence Q9NZQ7, Phe19 Arg238, with C hIgG1 Fc
Product Specification
| Species | Human |
| Synonyms | Programmed Cell Death 1 Ligand 1, PD-L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1 |
| Accession | Q9NZQ7 |
| Amino Acid Sequence |
Q9NZQ7, Phe19-Arg238, with C- hIgG1 Fc FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
|
| Expression System | HEK293 |
| Molecular Weight | 65-70 kDa (Reducing) |
| Purity | >95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.2, 5% trehalose |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
PD-L1, also known as B7-H1 and CD274, is a 290 amino acid transmembrane glycoprotein in the B7 family of immune regulatory molecules. It has an extracellular domain that can interact with PD-1, which belongs to the CD28/CTLA4 family expressed on activated lymphoid cells. The PD1/PD-L1 interaction ensures that activation of the immune system occurs at the appropriate time. This will minimize the possibility of chronic autoimmune inflammation. PD-L1 is known to inhibit proliferation of T cells via apoptosis. It also plays an important role in arresting cell-cycle progression. This makes PD-L1 an attractive therapeutic target for cancer and immunologic diseases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy