SKU: 21830345790

Fc epsilon RI α Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Fc epsilon RI α Fc Chimera Protein, HumanProduct Specification Species Human Antigen Fc epsilon RI Accession P12319 1 Amino Acid Sequence Val 26 Leu204, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen Fc epsilon RI
Accession P12319-1
Amino Acid Sequence

Val 26-Leu204, with C-terminal Human IgG1 Fc

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc epsilon RI, the high-affinity IgE receptor, distinguishes Ag-IgE interactions and drives cellular allergic responses. Fc epsilon RI is primarily expressed on MCs, basophils and Ag-presenting cells, and mainly exists as the heterotetramer αβγ2. However, there are differences among species: an alternate trimeric form αγ2 is expressed on human, but not rodent. Structurally, it is composed of one α-chain bearing two extracellular immunoglobulin domains that bind to the Fc portion of a single molecule of IgE, a β-chain that holds an immunoreceptor tyrosine-based activation motif (ITAM), and a homodimer of disulfide-bound ITAM-containing γ-chains. Expression of the β chain in mast cells and basophils results in increased Fc epsilon RI surface expression and amplifies signaling through the receptor. The importance of the α-subunit in the Fc epsilon RI-mediated allergic reaction was demonstrated by the absence of allergic reactions in α-subunit-deficient mice. The Fc epsilon RIα binds to the Fc fragment of IgE at a 1:1 ratio to form the IgE-Fc complex. Fc epsilon RI is a unique molecular target that initiates different functional outcomes of MC responses and allergic inflammation. The recognition of multivalent antigen by Fc epsilon RI-bound IgE triggers a complex biochemical pathway initiated by the phosphorylation of ITAM motifs by the Src family kinase Lyn. Fc epsilon RI not occupied by IgE has a half-life on the mast cell surface of 24 hours in vitro, while receptors bound to IgE appear to be expressed for the life of the cell. The density of human basophil FcεR1 expression correlates directly with serum IgE levels, where binding of IgE stabilizes the receptor at the cell surface.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21830345790

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Noelle
Boise, US
★★★★★ 5
Helped Tighten My Skin & Minimize Pores
Color: Cyano Pink Spicule, Color: Cyano Pink Spicule
I’ve loved the Dr. Melaxin Cyano Pink Spicule Serum! The bottle is small, but it lasted me around 6 months since I only use one pump every other night. When I first started using it, I noticed a tingling sensation, but over time my skin adjusted and I barely notice it now. I’ve definitely seen my pores appear smaller and my skin feels tighter and smoother after using it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
B
Verified Purchase
Brooke Ballinger
Carnegie, US
★★★★★ 5
Great for pore reduction
Color: Cyano Pink Spicule
This product works great!! it almost feels like an exfoliator. It reduced the pours on my nose, which were very big and now you can barely see them. I would recommend this product if you have large pores also make skin look firmer and smoother more for a night cream though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
Marcia Weldon
Lexington, US
★★★★★ 5
More than expected
Color: Cyano Pink Spicule
Love, love and recommended to friends. Leaves my skin feeling and looking great. At 69 I don't expect miracles but can definitely see an improvement in texture, glow and line minimizing. I'm hooked and will never be without!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
E
Verified Purchase
Eric S.
Bozeman, US
★★★★★ 5
Micro-needling effect!
Color: Cyano Pink Spicule
Love how you can feel the micro-needling effect. I use this is my first application after toning and follow up with my serum and moisturizing routine. I do believe it gives my face a plump feeling, especially after gua sha. Will continue to use in my daily!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
M
Verified Purchase
Michelle B. Govertsen
Dallas, US
★★★★★ 4
Helps my moisturizer absorb better
Color: Cyano Pink Spicule
I’m not quite sure if the product is fully working the way it is supposed to but I do like that when I use this and the apply moisturizer, it absorbs into my skin better and leaves my skin smoother and a lot less greasy. It’s easy to throw in my travel bag because of the size and you really only just need a little for each use so it goes a long way got the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products