SKU: 22810674892

Biotinylated BCMA His&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA His&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 15 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

15-17kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi & Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma: rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985-1005 (2020).

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22810674892

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
E. L. Phipps
Lexington, US
★★★★★ 4
Loose under eye skin tightened and brightened!
I love this cream! It makes a huge difference in the strength of the skin under my eyes and smooths the look and feel of the wrinkled skin under my eyes. It brightens my under eye circles. I gave 4 stars because if you use too much it will start to roll off almost like skin does when it sheds or when you exfoliate. I use less now and it’s perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
E
Verified Purchase
Emma DG
Grantham, US
★★★★★ 5
Working on Deep Wrinkles Great Results
I really like this product, it’s been working well on deeper wrinkles, especially on my forehead and around my smile lines. With consistent use, I can see a noticeable improvement in how my skin looks. The texture feels hydrating and smooth, and it absorbs nicely without feeling heavy. It leaves my skin feeling softer and more refreshed after each use. I also like that it helps with overall skin appearance, making it look more even and a bit more radiant. Minor note: Results take consistency, so it’s best to use it regularly to see the full effect. Overall, this is a great product for targeting fine lines and deeper wrinkles. Hydrating, easy to use, and delivers visible improvements over time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
M
Verified Purchase
Mary Kruse
Battle Creek, US
★★★★★ 3
Didn’t live up to the hype.
I had high hopes for this product. I’ve seen it all over social, but for me it didn’t live up to the hype. Although it is very moisturizing, it never dries down. There’s no way I could apply makeup over this, as the ads might lead you to believe. If you want a good night time moisturizer then this product is for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Cyndi
Omaha, US
★★★★★ 1
No Good
So I got this under the impression by the videos online that this was really concealing under the eye and it’s not…very oily and hasn’t done anything for under my eyes at all! Scam!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
Q
Verified Purchase
Quona
Whiting, US
★★★★★ 5
Great product!
Love this product. Lightweight and feels great on the skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products