SKU: 23098685157

Human TIMP-1, His tag

Sale price$222.75 Regular price$247.50
Save 10%

Pay in installments of $61.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TIMP-1, His tagProduct Specification Species Human Synonyms Erythroid potentiating activity (EPA), Fibroblast collagenase inhibitor (Collagenase inhibitor), metalloproteinases inhibitor 1 Accession P01033 Amino Acid Sequence Protein sequence (P01033, Cys24 Ala207, with C 10*His)

Product Specification


Species Human
Synonyms Erythroid-potentiating activity (EPA), Fibroblast collagenase inhibitor (Collagenase inhibitor), metalloproteinases inhibitor 1
Accession P01033
Amino Acid Sequence

Protein sequence (P01033, Cys24-Ala207, with C-10*His) CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 22.3kDa Actual: 33kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

TIMP metallopeptidase inhibitor 1, also known as TIMP1, a tissue inhibitor of metalloproteinases, is a glycoprotein with a molecular weight of 28 kDa.TIMP1 is expressed from several tissues of organisms. TIMP1 is an inhibitory molecule that regulates matrix metalloproteinases (MMPs), and disintegrin-metalloproteinases (ADAMs and ADAMTSs). In regulating MMPs, TIMP1 plays a crucial role in extracellular matrix (ECM) composition, wound healing, and pregnancy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23098685157

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MSPDX97214
Lowell, US
★★★★★ 5
Very handy
Color: Sienna
I purchased it because I still use paper boarding passes. With luggage claim paper, your passport and ID card, things could get quite messy if you try to put everything in your bag or backpack’s compartment. This one organizes all those nicely. Because of its size it accommodates multiple boarding passes and luggage claim papers easily. (They used to get crumpled in international flights, and It annoyed me.). Yet it is compact enough to carry in your pocket. One negative is its price. It is expensive. But it is a quality product. Nice leather and well made. If you are willing to spend some $, this will spare you from searching your boarding pass and passport frantically at boarding. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 4, 2025
J
Verified Purchase
JAD
Houston, US
★★★★★ 5
Excellent product, great for travel
Color: Cocoa
I just got back from a business trip and this is by far the most useful passport holder/wallet I've ever used. Lots of room for cards, bills, boarding passes, and a second passport and still folds very flat. Leather is good quality, and is very well put together. Since its too big for my pocket and will mostly live in my briefcase, I expect it to last a very long time. The only drawback is the high price, especially since the leather is probably not full grain (it's not advertised as full grain, so we can assume it's not). But it fits my needs perfectly, even if it is a little overpriced.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2023
F
Verified Purchase
Faith K.
Battle Creek, US
★★★★★ 5
Highly recommend.
Color: Cocoa
My favorite purchase for a recent trip across three continents. Fits in pocket (I mean it’s a tight fit, but it will fit). Perfect in cargo pant pocket. Has two separate compartments for paper bills which is nice - you can keep your home currency in one and travel currency in the other. Really sleek looking. Bought four of these and we all loved ours. Highly recommend. 
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 4
Nice wallet. Just received it and used on trip to Italy
Too early to rate for durability, but it came quickly, looks nice, and appears to be well-made. Was a godsend on my trip to Italy and back. With all the times you have to show your passport (usually dragging your luggage with you), my passport was always at the ready, secure in my wallet in my pocket. I would not travel abroad without it. Not only that, it will serve as my daily wallet as well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2023
J
Verified Purchase
Josh
Phoenix, US
★★★★★ 5
Pen holder feature isn't good
Color: Cocoa
Edited review: previously I gave this a two-star review because when I inserted the pen into the pen holder the wallet couldn't close anymore... I tried taking it out putting it back in a few times and it seemed obvious to me that something was wrong and I just could not figure out why the wallet possibly was having an issue closing even though it's designed to hold a pen... To me it seemed obvious that when inserting the pen you should have the clip on the inside where are the bills go.... That single millimeter of space that that clip takes up in the bill fold causes the wallet to not be able to close properly so it springs open. Needless to say that felt extremely cheap for a product of this price and I was very unhappy and considering a return and after writing a bad review I happen to see product pictures with the clip on the inside of the wallet where your cards go and it dawned on me that I had just simply put the pen in in the wrong orientation. That completely solves the issue. So updated back to five stars, and the wallet is great. 2n update after using it for a week on an international trip so I was carrying my passport. Worked great - made me feel safe to always have my passport and room for all my most important documents inside a -just- large enough for a passport wallet. I really don't think they could have saved another millimeter and still made such a quality wallet. Having a micro pen in there is icing on the cake - makes you feel like James bond. I also felt safer having a hidden bill compartment so your not showing a fat stack of foreign currency (I mean depends on your use case but I was in some rather poor areas and this added some peace of mind and 'security' in my opinion). You can just keep some small bills up front and your real stack on the hidden flap. I won't dock a star for it - but keeping this on a back pocket so you're sitting on it because it's bigger and the way it holds cards after just one week there's already card imprints on the leather (just imagine your older leather wallets where the cards start wearing through the leather) Also I tested the RFD blocking and it indeed works. I'm unable to scan any cards through the wallet and that was an important feature to me. Even when the wallet is open and I ran scanners directly over cards (in the sleeves) it still didn't pick anything up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026

recommand products