SKU: 2353981722

CEACAM-1/CD66a His Tag Protein, Cynomolgus

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-1/CD66a His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI Accession XP_005589426. 2 Amino Acid Sequence Gln35 Gly428, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI
Accession XP_005589426.2
Amino Acid Sequence Gln35-Gly428, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLSQNLIGYNWHKGERVDAKRLIVAYVIETKQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGQFRVYPELPKPNITINNSNPVEDKDVVTFTCESEAQDTTYLWWVNNQSLPVSSRLQLSNGNKTLTLLSVLRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCSAASNPPAQYSWLINETFQQSTQELFIPNITVNNSGSYTCHANNSVTGRNRTTVKMIIVSEQSLVVAQPQIKASKTTVTEDKDYVNLTCSTNDTGISISWFFKDQSLPSSERMKLSQDNATLSINPVKREDAGNYSCEVFNLISKNRSDPIVLIVNYNNPAQENSLPAGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 65-93kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Tsugawa N. et al. (2021) CEACAM1 specifically suppresses B cell receptor signaling-mediated activation. Biochem Biophys Res Commun. 535: 99-105.

Background

Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) is a type I transmembrane glycoprotein and a member of the CEA family. The extracellular domain of CEACAM1 consists of a membrane-distal immunoglobulin (Ig)V-like N-region and variable numbers of alternating IgC1- and IgC2-like proximal regions. Therefore, this molecule is also classified as a member of the Ig supergene family. Several heterophilic ligands for the N-domain of CEACAM1 have been reported. However, homophilic ligation of the N-domains of CEACAM1 with another N-domain of CEACAM1 is the predominant means of physiologic interaction. CEACAM1 has been reported to be involved in several functions such as tumor growth, angiogenesis, endocrine function and immunology in humans and rodents.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2353981722

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
smarch104
Battle Creek, US
★★★★★ 5
Better than our actual mattress!!
Style: 22", Color: Grey, Size: Queen, Style: 22", Color: Grey, Size: Queen
Purchased for company to stay with us in our apartment. I honestly had no idea they made air mattresses this tall until I saw a friend with one! My husband and I tested it out last night. We were both really impressed! 1. Really easy to inflate! First time having an internal air pump. No more forgetting the pump! The motor wasn’t nearly as loud as our previous air pump! I was able to talk to my husband and he could still hear me over the pump running. 2. Really comfortable and supportive! We chose not to inflate it fully so it contoured to our bodies better. We slept on the mattress with no sheets and I wasn’t able to feel the creases in the top which was nice. No issues with sagging and we both didn’t wake up smooshed in the middle. My husband got up in the middle of the night and I didn’t notice. So movement of the mattress is minimal! Easy to get on and off with the 22” height. 3. Easy to deflate! We followed the instructions for folding and we got it in the storage bag with no issues. Just make sure all of the air is out before you fold it. 4. High quality! We had both of our small dogs on this with us. I was afraid of their nails poking a hole but so far so good! Only a little bit of air leaked out but it could’ve been the material stretching out during the night. Cons: The pump does not shut off automatically when inflating or deflating. So keep an eye on it so it doesn’t overfill. The mattress does get cold at night. My husband and I both mentioned that in the morning. I had to roll up in my blanket to stay warm. I’ll try sheets on next time. In the summer it might not be that big of an issue. Ours came with one patch. Hopefully we won’t need to use it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
F
Verified Purchase
Fashionista21
Dallas, US
★★★★★ 5
Excellent pillow
Size: King Size Pack of 1, Color: White
This is a great pillow!! I ordered this for my elderly mother who wanted a softer pillow. She absolutely loves this one. It’s supportive, keeps her cool also keeps its shape. I love that it came with extra stuffing so you can customize it. Well worth the price!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
A
Verified Purchase
Anahi cuevas
Whiting, US
★★★★★ 5
Very comfortable pillow
Size: Queen (1 Count), Color: White
I’ve been sleeping with this pillow for a few nights and I really like it. It’s soft but still supportive, and it stays cool during the night. I also like that you can adjust the filling to make it more comfortable. Definitely helped me sleep better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
A
Verified Purchase
Adam
Battle Creek, US
★★★★★ 4
Fantastic pillow for the price, adjustable is a different ball-game entirely.
Size: Queen (1 Count), Color: White
Overall, I'm quite pleased with this. The fact that it is fully adjustable (adding or removing foam, and they give you a bunch extra) is a massive boon as I like pillows to be pretty low profile. It feels nice to the touch, and compresses nicely but not a ton like down. The memory foam that is inside of it seems to be combined with some kind of a harder material, it's all shredded so I can't tell what it is, but it seems like maybe plastic or something of the kind. Hasn't been an issue in any way, but was just weird feeling it when removing foam. I took a point off because there seems to be some false advertising going on. You can see in their picture that there is a tag that says bamboo side, the other side of that says cooling side. They also mention it in their advertising. As far as I can tell that is not true at all. The cover unzips so that you can remove the material so you can see that there is nothing on either side of it, and both sides appear visually identical to each other. Certainly I would NOT call this a cooling pillow in any way. It's maybe decently cool if you leave it in a cool place for a while, but over the course of the night warms up quite a bit. I did not notice any appreciable difference in the cooling of either side of it. There is a definite noticeable smell to it, but I wouldn't call it 'bad' like most memory foam things are when they come from the factory. It smells kind of like some kind of cleaning solution in a noticeable but not unpleasant sense. All in all, for the price this is a fantastic pillow and I would definitely recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
J
Verified Purchase
Joshua Sojka
Charlottesville, US
★★★★★ 5
Most Comfy Pillow Ever Used
Size: King Size Pack of 2, Color: White
I recently purchased the BETU Cooling King Size Pillows Set of 2, and I have been thoroughly impressed with their quality and performance. These pillows have truly transformed my sleeping experience, making them an essential addition to my bedroom. First and foremost, the shredded memory foam provides fantastic support while remaining incredibly comfortable. These pillows adapt perfectly to my head and neck, offering excellent support for back, neck pain relief, and side sleeping. The adjustability of the memory foam allows me to customize the firmness to my liking, ensuring a perfect balance between soft and firm support. This customization has made a tremendous difference in my sleep quality, reducing any discomfort and ensuring I wake up feeling refreshed and pain-free. One of the standout features of these pillows is their cooling capability. As a hot sleeper, I struggled to find pillows that keep me cool throughout the night. The BETU Cooling Pillows effectively dissipate heat and maintain a comfortable temperature, allowing me to enjoy a restful and uninterrupted sleep. The cooling technology is truly a game-changer for anyone who tends to overheat during the night. The pillow covers are another bonus. They are soft, breathable, and easily removable for washing, ensuring that the pillows remain fresh and hygienic. The white cover adds a clean and elegant look to the bedding, making them aesthetically pleasing as well. The king size is generous and luxurious, providing ample space and comfort. Whether used for sleeping, lounging, or reading in bed, these pillows offer an unparalleled level of comfort and support. In summary, the BETU Cooling King Size Pillows Set of 2 is an exceptional product. The combination of shredded memory foam, adjustable firmness, and cooling technology makes these pillows perfect for hot sleepers and those in need of superior support for back and neck pain. The high-quality covers and overall design further enhance their value. I highly recommend these pillows to anyone looking to improve their sleep quality and comfort.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2025

recommand products