SKU: 23563406702

CD39 His Tag Protein, Mouse

Sale price$522.00 Regular price$580.00
Save 10%

Pay in installments of $145.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD39 His Tag Protein, MouseProduct Specification Species Mouse Synonyms Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto ATPDase 1 Accession P55772 1 Amino Acid Sequence Thr38 Ile478, with C terminal 8*His

Product Specification


Species Mouse
Synonyms Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto-ATPDase 1
Accession P55772-1
Amino Acid Sequence

Thr38-Ile478, with C-terminal 8*His

TQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGGGSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 72-90kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD39 is also known as Ectonucleoside triphosphate diphosphohydrolase 1, ENTPD1, NTPDase 1, Ecto-ATPDase 1, in the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation by hydrolyzing platelet-activating ADP to AMP. Hydrolyzes ATP and ADP equally well. NTPDase-1 was originally described as CD39, a B lymphocyte cell surface marker, but it is also present on the surface of natural killer cells, T cells, and some endothelial cells. Regulatory T cells (Tregs) mediate immunosuppression through multiple, non-redundant, cell-contact dependent and independent mechanisms, a growing body of evidence suggests an important role for the CD39-CD73-adenosine pathway. CD39 ectonucleotidase is the rate-limiting enzyme of a cascade leading to the generation of suppressive adenosine that alters CD4 and CD8 T cell and natural killer cell antitumor activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23563406702

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Brandon Pittman
Phoenix, US
★★★★★ 5
Soft, Warm, and Holds Up Well After Washing
We grabbed this primarily for couch lounging and it has been a regular rotation blanket since it arrived. The softness is legitimate, not the kind that feels good out of the packaging and then stiffens up after a wash or two. It has gone through the machine multiple times and both the texture and the leopard print have held up without fading or pilling. The 50 by 60 inch size is a comfortable fit for one person stretched out on the couch. It is warm without being heavy, which makes it practical across seasons rather than just winter. The print looks sharp and adds some personality to a living room without being over the top. For a throw blanket at this price, the quality is better than expected and it has earned a permanent spot on our couch. If you are looking for something soft, visually interesting, and durable enough to actually use regularly, this one delivers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Canadian reviewer
Houston, US
★★★★★ 5
Pretty good blanket. Slightly larger than normal throw.
I purchased this leopard print throw blanket because you can get it in twin size and twin size is a lot more usable in not only a bed but also on a couch. Like if you have two people sitting next to each other, it's a lot easier to use the twin size than a throw size, which I feel is a little bit cramped. In addition to that, I saw in the picture that this looked almost like fur. Now when you look at it in person, you can clearly tell it's not for it's got almost like a a spotted pattern even with the spots. And while I don't know if leopards actually look like that, certainly at a distance, it feels a lot more accurate than things that are only vaguely leopard printed like the the common pink ones, as you can see here in the other variety. But certainly the Brown leopard one looks good. Plus, it is comfortable and pretty soft. It's softer on one side than another side, but only slightly and while it's rolled over and stitched at the edges, it is a single layer throughout. So it's not going to give you a ton of warmth. But I will give you some warmth, you know just enough to be nice and that means you can use it year round. So overall at this price for a twin size leopard print throw. I think this is a good deal. Well I think it could be a better deal. I've certainly seen worse so I think I could recommend this product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
M
Mona Peters
Birmingham, US
★★★★★ 5
Pink cheetah blanket
Color: Pink Leopard, Size: Throw(50" x 60")
I recently got this pink cheetah print throw blanket, and honestly, it’s such a fun and cozy addition to my space. The first thing that stood out to me was the design—the pink leopard print is super cute and adds a pop of personality to my couch without being too overwhelming. The material is really soft and lightweight, which makes it perfect for everyday use. It’s warm enough to keep me comfortable while lounging or watching TV, but not too heavy where it feels bulky. I also like that it’s easy to fold and move around, whether I’m using it in the living room or taking it to bed. Size-wise (50” x 60”), it’s a good throw size—great for one person, though if you’re looking to fully wrap up, it might feel a bit small. The quality feels decent for the price, and it seems to hold up well after use without shedding. Pros: • Super soft and cozy • Cute, trendy design • Lightweight and easy to use • Good value for the price Cons: • Slightly small if you want full coverage • Not the thickest blanket for colder nights Overall, I’d definitely recommend it if you’re looking for something stylish, comfy, and affordable to decorate your space while staying cozy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
P
Verified Purchase
Pam Kullerd
Pawtucket, US
★★★★★ 5
Good quality
Color: Pink, Size: 50"Wx60"L
My great granddaughter asked for this throw so I purchased it for her. The throw is so soft and looks exactly like the picture. The quality is good and the price was right. It’s light weight so she can roll it up and throw in her backpack to take to friends houses. I received the throw on time and I would recommend this product and seller.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
L
Verified Purchase
Love this dress
San Leandro, US
★★★★★ 3
It sheds
Color: Pink, Size: 50"Wx60"L
When I bought the blanket with the assumption that it would be pink leopard on both sides. Unfortunately, when I retrieved, my package it was white on the inside and pink leopard on the outside. It was nice until it started to shed so I gave it to my sister. I did not like the size I should've gotten something way bigger. It will keep you warm though. Especially during your period. It wasn't all the way soft because one side was odd the other is what you actually offer so that part I didn't like very much. Overall it does get the warming job done.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products