SKU: 23566562288

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23566562288

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bee-Bee
Louisville, US
★★★★★ 5
Excellent pillows that are worth the cost
Size: Queen / Standard, Color: White
These are wonderful. Completely relieved my back pain the first night I slept on them -– I put one underneath my back as I slept, and a weeklong terrible pain vanished overnight. Felt like sleeping on a cloud. As others have noted, they are neither too soft nor too firm…they’re really just right, and I think would make great guest room pillows since everyone would like them. These were definitely worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
J
Verified Purchase
JBaranow
Pawtucket, US
★★★★★ 5
Great , fluffy pillows
Size: Queen / Standard, Color: White
They came compressed into a small roll so I was wondering how they would do. BUT they fluffed up to incredible size and comfy feel. I am impressed so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Carol
San Leandro, US
★★★★★ 5
Pillow comfort and quality
Size: Queen / Standard, Color: White
Bought this for my husband. He is very happy with it. It is well constructed. He doesn’t like too firm or too soft. It meets those requirements. Very reasonably priced. I have bought very expensive pillows that aren’t even comfortable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
Jesse Raya
Houston, US
★★★★★ 4
Pretty good.
Size: Queen / Standard, Color: White
Me and my fiancé have been going through a lot of pillows, trying to find the right ones. We go to this local hotel to unwind and use the whirlpool sometimes. Their pillows are immaculate. So I starting looking at “Hotel Pillows”. These are not the same as the hotel pillows, not even close tbh, but they are the best ones I’ve bought so far. They are comfy from day one. I was worried when opening the box and seeing that they had the same cover on them as others I bought before, but they were not the same. Pretty comfortable, and less neck pain than any of the other ones. My house is like the house of pillows and I am finally going to start getting rid of the old ones. Maybe we’ll find some down pillows to put on our registry, but until then, these are staying on my bed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
R
Verified Purchase
Ricardo
Grantham, US
★★★★★ 5
Great pillows
Team Name: Pack of 2, Size: Queen - 20" x 30", Color: White
These are very comfortable, after few sleeps since I got them, they haven't got flat at all, they are really good looking, retain shape well even inside a pillow case, they fit perfect on queen size pillow cases, and they dont get hot while asleep.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products