SKU: 24810629210

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24810629210

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Power Adapter
Pawtucket, US
★★★★★ 4
Fine, dry glitter in a puff spray bottle
Color: Glint Rainbow
This works well if, and only if, you know exactly what it is and if it'll work for your application. This glitter comes with no adhesive or stickiness in it. It is not like a glitter stick, or glitter makeup. It is dry glitter in a spray bottle. The spray pattern is very narrow, so if you want to spray it onto a piece of paper or you body, it will show up in a clump. It does not have an airy spray pattern. To use this, you need to add some stickiness to the surface you want it to stick to first. Something like glue on paper or some sort of sticky thing on your skin that won't sink in. If regular lotion sinks in, the glitter will just fall off. So petroleum jelly or something that sits on top works best. Also, if you want it spread out instead of in little clumps as it comes out of the spray bottle, you'll have to move it around manually. On some level, to be entirely honest, I'm not sure this application method is better than loose glitter. With loose glitter, at least I can manually sprinkle it and not get a giant blob like with the spray. Also, some little bits get loose with the spray, and loose glitter in a house is just asking for forever glitter. I'm deducting one star simply because the spray delivery mechanism isn't very useful, and can actually be a liability. Unlike some spray glitters with propellant and adhesive that are more like spray paint and have a more spray paint application profile. This manual puff method just doesn't work well with glitter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
T
Verified Purchase
Tamiyah Thomas
Whiting, US
★★★★★ 5
Dry glitter, not glue
Color: Glint Rainbow
This is dry glitter, not glitter spray. Will need glue for it to stick but it’s very pretty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
R
Rylie
Bozeman, US
★★★★★ 5
Fine holographic sparkle with smooth and even application
Color: Glint Rainbow
I tested this glitter powder several times over about two weeks while using it on my hair and along the cheek area for festival style makeup looks. The shimmer particles are very fine, which helps create a smooth reflective effect rather than chunky glitter. The applicator releases a light dusting of powder, which makes it easier to control how much product is applied. I found that building it gradually works best, starting with a light layer and adding more for a stronger sparkle effect. The holographic finish reflects different tones depending on the lighting, shifting slightly between soft rainbow colors under brighter light. It looks subtle indoors but becomes more noticeable and reflective in direct lighting or outdoor settings. During wear, the glitter stayed in place for several hours with minimal fallout when applied lightly. I noticed that applying it over slightly set makeup or hair helped it adhere better and reduced loose particles. With its fine texture, controllable application, and noticeable sparkle under different lighting, it delivers a versatile glitter effect for creative makeup looks. The quantity of the spray was nice and it was durable under the sun too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
J
jsnggltt
Pawtucket, US
★★★★★ 3
Glitter Bomb
Color: Glint Rainbow
It gets ALL over the place and doesn’t stick all that well. Neat idea but it doesn’t work the way I would hope.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
T
Verified Purchase
Tammy James
Fort Morgan, US
★★★★★ 5
HEALTH & BEAUTY
Flavor Name: XL silicone socks 2 pairs
LOVE IT
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026

recommand products