SKU: 25172299126

TREM2 Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TREM2 Fc Chimera Protein, HumanProduct Specification Species Human Antigen TREM2 Synonyms TREM 2, Triggering receptor expressed on monocytes 2 Accession Q9NZC2 1 Amino Acid Sequence His19 Ser174, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen TREM2
Synonyms TREM-2, Triggering receptor expressed on monocytes 2
Accession Q9NZC2-1
Amino Acid Sequence

His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013.

Background

Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25172299126

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Jennifer Renee Shipman
Charlottesville, US
★★★★★ 5
Coolest wireless charger design I've seen
I just gotta say that this is the coolest design for a wireless charger, looks kinda futuristic. Now how well does this work? Amazingly well and truly easy to use. It is adjustable, stable and much safer for everyone. I really like this charger.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
G
Gus A.
Lexington, US
★★★★★ 3
Wow that light color ring is annoying
There is no way to turn this color light off. I don't even know why it has to have a light at all. I suppose it is to tell you it has power. But the light could have been something that momentarily turns on and then off as you place the phone on. I'm a DIY'er and I'm going to find a way to take this apart and disable the light. I'll report back if I'm successful. The good news is that this mount is identical to another one I have except for the magnet charging section. I'm talking it is identical down to the knobs and metal arm so it's generic in that sense. They only changed out the magnetic section. This type of mount holds well to the screen. The charging speed seemed adequate. Not terribly fast but not slow. Wirelessly charging is always slower than plugged in. The supplied USB cable is braided and feels like quality. See attached picture. This mount is not something you'll necessarily want to use every time you drive. Therefore the color ring is annoying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
C
Check this out America!
Fort Morgan, US
★★★★★ 5
SLEEK EXTENDABLE SCREEN MOUNT
HIGH SPEED TESLA MAGSAFE POWER i picked this up for my Model 3 to see if the 25W Qi2.2 charging actually lives up to the hype during my daily work week. ✨ The CNC aluminum build is top notch and feels much more robust than the flimsy plastic mounts i have tested. It's a piece of cake to clamp onto the corner of the Tesla screen and the metal arm matches the interior aesthetics perfectly. The magnetic hold is strong enough to keep my phone secure even when i am taking sharp turns thru my weekend adventures. ✨ Performance is where this thing shines because it actually delivers the 25W speeds without overheating. The built in cooling fan is a smart design choice that keeps the temperature down during long drives. i can hear the fan if the music is off but it's barely noticeable and definitely worth it for the consistent charging speed. ✨ The RGB lighting adds a subtle glow that makes it easy to find the mount in the dark without being distracting. Having the extendable arm is a big benefit for finding the perfect line of sight without blocking the main touchscreen. It's clearly a well thought out solution for any Tesla owner who wants a professional grade charging setup. THE VERDICT This is a exceptional piece of hardware that delivers real world results for high speed charging. The combination of active cooling and a sturdy metal build makes it a first class addition to my car. 'As a 35 year veteran of the computer technology industry, I offer informed and experienced perspectives in my product reviews.' I will update this review if anything changes within 1 year. ★★★★★ (5 Stars): A 5 star rating indicates the product meets my expectations for its purpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
B
Verified Purchase
Brett C Stutz
Lowell, US
★★★★★ 5
Works great. Perfect position
Grip and charging are great. I like the position because it doesn't block my view or the vents
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
C
Cindy
Phoenix, US
★★★★★ 5
Great design. Love it.
I have been using this charger for several months now. I think the design is fantastic. I've seen other reviews which question the reliability of it. My experience has been the opposite. I have a folding phone so it's not light. The connection to the dash has remained intact without fail. I am careful when removing the phone. I don't just yank it off. It charges as it should. The magnetic force is what I expected. Holds my phone with no issues or concerns it could fail and drop the phone. It's super convenient to have this integrated design. My dash is already occupied with a portable android auto unit. My 4Runner is older and did not have that feature. Again, this is plastic. Handle it with some care and I don't see anyone having issues with breaking. It has worked out great for me. Recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2025

recommand products