SKU: 25611412820

Human Stratifin/14-3-3 sigma Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Stratifin/14-3-3 sigma Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1 Accession P31947 Amino Acid Sequence Protein sequence (P31947, Met1 Ser248, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1
Accession P31947
Amino Acid Sequence

Protein sequence (P31947, Met1-Ser248, with C-His Tag) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Expression System E.coli
Molecular Weight Predicted MW: 29.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein sigma (SFN), also known as Stratifin, is a crucial member of the 14-3-3 family. It functions as a phospho-serine/phospho-threonine binding protein that regulates a wide array of cellular processes, including cell cycle progression, apoptosis, and stress response. A key and well-characterized role of 14-3-3 sigma is its involvement in the DNA damage checkpoint, where it is transcriptionally activated by p53 and helps arrest the cell cycle. It often acts as a tumor suppressor, and its expression is frequently lost in various cancers through epigenetic silencing. Furthermore, 14-3-3 sigma is implicated in epithelial cell biology and is a significant marker in cancer research and diagnosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25611412820

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Sycokittykat - Steff
Birmingham, US
★★★★★ 4
Hardcore bullying and mistreatment to HEA
Format: Kindle
First off the men do not know she is their scent match. This does not excuse the way the treated her. These men bought her in hopes of using and unregistered Omega to get info on the Omega they might as kids.  Every single one of these characters has been abused growing up. The men think she is just some spoiled princess and their way to find someone they have been searching for. What they don't expect is to slowly find themselves drawn to her more and more but not understanding why.  These men starting acting weird and possessive but never suspected why. Once they discover the truth they have to work really hard to make it up to her. Especially after she put them in contact with the Omega they had been looking for then she ran.  I definitely felt for these men as their story was revealed. I definitely wanted to hold them and promise they were safe now.  That little surprise at the end I definitely didn't expect but it was fantastic. 
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
J
Jennifer G
Fort Morgan, US
★★★★★ 3
Rights Didn't Balance the Wrongs
Format: Kindle
Eva was sold to a pack as an unregistered Omega by her own father. Unwanted. They wanted her as a means to an end, not for who she was. But she knows the truth. They are her scent matches. They don't realize that because of the suppressants she is on. It's better this way. They would be slaves to biology if they knew, and now she knows the truth. Eva will gain her freedom, and when she does, she will make sure they realize exactly what they lost. I love a rejected mate's story with a good redemption arc. Bring on all the groveling. This wasn't as satisfying as I had hoped for. Too much spice, too little story. There was little romance, affection, or redemption. Consent was questionable. And Eva's fears about biology weren't disproven. The Alphas were controlled by their scent match, and Eva was no better. The Alphas didn't have any character growth. It wasn't only their "Omega" but all of the women they entertained in the house. Even sitting on the couch would have sent an Omega into hysterics. The house and furniture were ruined. Wrongs were done - trafficking, abuse, captivity, dubious sexual encounters. There weren't enough rights to balance out the wrongs, so the Alphas stayed ruined. There were no swoon-worthy declarations or actions. There were some gifts and some redecorating, but most was off-page. Where was the over-the-top shopping trip and romantic gestures? Where were the intimate conversations? Did they ever gain Eva's trust? I'm not even sure "I love you's" were exchanged by everyone. Was there love or only scent? I don't know, so this story was not a success for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
S
Verified Purchase
Scgirlie
Carnegie, US
★★★★★ 5
Surprisingly good!
Format: Kindle
I wasn’t sure I could forgive them and that’s always my issue with betrayal books - can I forgive the mmc, plural in this case, but the author was absolutely able to get me to that point. Yea I struggled with one them especially but overall I loved the book!! Followed the author immediately
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
M
mandie
Chelsea, US
★★★★★ 4
Amazing read!!
Format: Kindle
Where to begin. I loved this book. The characters had a way of pulling you in and making you holding your breath at the same time. I absolutely loved the fmc. Eva has a way of being vulnerable but strong. She is unwilling to give up. The mmc’s are truly horrible at the beginning. With that being said, I still found myself rooting for them. Over time you could them changing and how even when they wanted to hate her they just couldn’t find it in them. A truly remarkable love came from a terrible beginning. Loved it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
S
S.O.
Los Angeles, US
★★★★★ 3
Not bad but read better omegaverse
Format: Kindle
Mmm. I have feelings. Some not good. Some good. It was an ok read. I've been on a omegaverse kick for awhile now. Love me some groveling alphas but this wasn't it. Actually there wasn't enough groveling and the fmc gave in WAY too quickly. They all have f'ed childhood. The alphas, Dorian, Rafe and Cade met at an orphanage that did unspeakable things to them until Dorian and Rafe aged out at 18 and had ti wait a few years until they could "adopt" Cade, who was 3 years younger than them. They all become successful entrepreneur of sort, I think. They created an app called HeatLink. The fmc, Eva, was sold to the pack by her horrible, abusing father. She endured just as much hardship. She is relentless with escaping the pack but she always gave in when they got too near. Like she couldn't keep her legs closed. She hates them but gave in everytime. I found her kind of weak in that sense. The overall plot was fine. Didn't leave me yearning to read the next page. I did clock one of the identity of someone quickly though. Don't want to spoil it. Again, I've read better omegaverse books. The one good thing about the book is one of the lines from Cade on page 218: ""Please Eva. I'm sorry." She staggered back and I followed her on my knees, dragging myself. I didn't care. I just wanted her to hold me."" I'll admit, I melted a little bit for Cade, even though he was probably the worse a-hole out of the bunch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026

recommand products