SKU: 26283150429

Human FABP7, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FABP7, His tagProduct Specification Species Human Synonyms Brain lipid binding protein (BLBP), Brain type fatty acid binding protein (B FABP), Fatty acid binding protein 7, Mammary derived growth inhibitor related, BLBP, FABPB, MRG Accession O15540 Amino Acid Sequence Protein sequence (O15540, Val2 Ala132, with C 10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms Brain lipid-binding protein (BLBP), Brain-type fatty acid-binding protein (B-FABP), Fatty acid-binding protein 7, Mammary-derived growth inhibitor related, BLBP, FABPB, MRG
Accession O15540
Amino Acid Sequence

Protein sequence (O15540, Val2-Ala132, with C-10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 16.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7, brain (FABP7) is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. FABP7 is expressed, during development, in radial glia by the activation of Notch receptors. Reelin was shown to induce FABP7 expression in neural progenitor cells via Notch-1 activation. According to one study, FABP7 binds DHA with the highest affinity among all of the FABPs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26283150429

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JBaranow
Battle Creek, US
★★★★★ 5
Great , fluffy pillows
Size: Queen / Standard, Color: White
They came compressed into a small roll so I was wondering how they would do. BUT they fluffed up to incredible size and comfy feel. I am impressed so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Carol
Battle Creek, US
★★★★★ 5
Pillow comfort and quality
Size: Queen / Standard, Color: White
Bought this for my husband. He is very happy with it. It is well constructed. He doesn’t like too firm or too soft. It meets those requirements. Very reasonably priced. I have bought very expensive pillows that aren’t even comfortable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
Jesse Raya
Carnegie, US
★★★★★ 4
Pretty good.
Size: Queen / Standard, Color: White
Me and my fiancé have been going through a lot of pillows, trying to find the right ones. We go to this local hotel to unwind and use the whirlpool sometimes. Their pillows are immaculate. So I starting looking at “Hotel Pillows”. These are not the same as the hotel pillows, not even close tbh, but they are the best ones I’ve bought so far. They are comfy from day one. I was worried when opening the box and seeing that they had the same cover on them as others I bought before, but they were not the same. Pretty comfortable, and less neck pain than any of the other ones. My house is like the house of pillows and I am finally going to start getting rid of the old ones. Maybe we’ll find some down pillows to put on our registry, but until then, these are staying on my bed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
E
Verified Purchase
Edma
Belleville, US
★★★★★ 5
Finally a pillow that works – excellent neck support
Color: Crescent White, Size: Queen
After trying and spending money on several pillows over the years, this is the first one that has truly worked for me. What makes this pillow stand out is the adjustable fill. Being able to customize the height and firmness made a huge difference in finding the right level of support for my neck and shoulders. The crescent shape is also very comfortable and helps keep my head and neck properly aligned while sleeping. Since using this pillow, I have noticed a significant improvement in comfort, especially around my neck. It provides support without feeling too firm or too soft, and it maintains its shape well throughout the night. The quality of the materials is excellent, and the pillow feels durable and well made. I appreciate that it can be adjusted to fit different sleeping preferences rather than being a one-size-fits-all pillow. Pros: * Adjustable fill for a customized fit * Excellent neck and shoulder support * Comfortable crescent design * Maintains its shape well * High-quality materials Cons: * None so far Overall: This is the first pillow that has truly worked for me after trying many others. I highly recommend it for anyone looking for better neck support and a more comfortable night’s sleep.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
J
Verified Purchase
Justin
Pawtucket, US
★★★★★ 5
Very nice pillow
Color: Cut-out White, Size: King
I was skeptical of spending this much money on a pillow, but so far I'm glad I did. It's very comfortable, and the shape does seem to help. I injured my neck/shoulder years ago, and I would wake up 1-2x per week heading slept wrong making my neck and shoulder stiff and painful in the morning. This pillow has so far prevented that. This pillow has also significantly reduced my snoring, according to both my Samsung watch and my wife. I'm a side sleeper. This pillow can be as firm or soft as you want since you can add or remove filling. It comes with a bag of extra filling just for that. I wouldn't say its cooling, but it certainly isnt too warm either. And I'm someone who sleeps hot. All in all, I'd buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products