SKU: 2671476529

Human CD40, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD40, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 5, B cell surface antigen CD40, Bp50, CDw40, CD40L receptor Accession P25942 Amino Acid Sequence Protein sequence (P25942, Glu21 Arg193, with C 10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CDw40, CD40L receptor
Accession P25942
Amino Acid Sequence

Protein sequence (P25942, Glu21-Arg193, with C-10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.1 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD40 is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of CD40 and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with CD40 and serves as a mediator of the signal transduction. The interaction of CD40 and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Moreover, CD40 molecule is a potential target for cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2671476529

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nathan Valentino
Pawtucket, US
★★★★★ 5
Sturdy and slim yet spacious and comfortable
Color: Derrick Brown, Size: One Size
Very nice! Fit about 10 cards total as well as about 10 bills. Would like to see how it holds up as I just got it today but I like it enough to write a review! I really like this wallet. I’m a bit of a stickler when it comes to having things near my butt area, but this fits great in my back pocket. I know it’s a front pocket billfold, but hey, I live on the wild side. I can wait until corona passes and I can walk up to the bar and whip this bad boy out to start a tab. It smells like a cowboy but presents like a stock broker. If you didn’t know me, and I pulled out this wallet, you would be very mystified. “Is this man classy? I think he might be! Look at fossil Derrick Front pocket Billfold” “wait, is that Derrick himself?” I’m not Derrick, but thinking about switching my name to Derrick because of how good this wallet is. The leather looks like it was cut from a Waygu bull with horns too big for a Cadillac. I’ll tell you what, this SOB is purtttttty. Would recommend to friends, family, and acquaintances. I would never pull this out in front of my enemy, in fear he might get the same wallet as me. The fossil message said this wallet is one of a kind, so the odds of someone else getting the same one is impossible. So, if I am the only one who has this wallet, how will anyone in the world find this review helpful? I guess you’ll just have to take a chance at getting a similar wallet to mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2020
J
Verified Purchase
J. Taylor
Pawtucket, US
★★★★★ 5
Nice simple wallet
Color: Derrick Brown, Size: One Size
I purchased this for my husband. It’s one inch shorter than his previous wallet, which had us worried at first. However, it fits all his cards. It has a nice look to it and time of good quality. My husband says he’s happy with it and really likes it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025
K
Verified Purchase
kunoh
San Leandro, US
★★★★★ 5
Expensive, but a well-made slim front pocket wallet
Color: Steven Medium Brown, Size: One Size, Color: Steven Medium Brown, Size: One Size
This is a review for the Fossil “Steven” Front Pocket Bifold Wallet. This wallet measures 4.5 inches x 3.0 inches. It is made with soft-touch leather all around (which feels fantastic), and the build quality is top-notch. It is definitely smaller than a typical wallet, but is still able to hold a good number of cards. I could easily fit about 12 cards into this wallet while still being relatively slim and compact. The wallet is discreet with only a “Fossil” logo that is embossed on the inside. The fabric lining of the cash compartment is treated with an anti-microbial coating. There’s more information about this coating on the manufacturer’s website, but it seems this is to protect against viruses and germs that maybe on cash notes. And while other wallets feature RFID Blocking, this wallet does not claim to do so. This wallet is definitely pricey. And you can easily find other slim wallets for much less. But, I suppose I’m paying for the brand name - and I do like Fossil products. So if you want a brand name wallet that is well-made and slim - this is a good option to consider.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2022
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 4
Noice
Color: Derrick Brown, Size: One Size
Nice wallet, preferred a different one, returned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
M
Verified Purchase
Marcus Lee
Lowell, US
★★★★★ 5
Slim but capable
Color: Steven Medium Brown, Size: One Size
I've had my old wallet for over two decades, it's warren and the edges are starting to fall apart and I thought I'd be proactive and get a new one before it was completely useless. With all the new slim minimalist designs I was intregeed. This is what I found out, at least for my needs. These new elastic card clips, are nice size wise, are not what the are advertised to be. They are small in your pocket but you need another place for the items you don't use everyday. So as far as being slim and efficient they are misleading. Unless you plan ahead you won't have what you need, say health insurance cards oops forgot them cause I don't use them everyday. Ones with cash clips or elastic bands aren't what they are cracked up to be either. To pull out a bill you need to take all the bills out unfold then and then refold the and squeeze the back in the clip, not covenant. Next I tried a bi-fold card holder with a money clip. This solved the having everything I needed even if I didn't use it everyday but still had the cash usability issue which required less folding but still needed to pull all the bills out to use. Plus it wasn't any dinner or smaller then my old wallet. Then I found this wallet, it was pretty much the same as my old one minus one card slot due to the visible ID slot. So in the end this was the perfect wallet for me. Not sure what my old wallet was as the leather is very well worn but I'm guessing it is the same brand. One other thing this wallet is not scan protected which the other slim wallets were. But you can buy cheap sleeves to place on either side to protect against this if your concerned. One benefit of not having this feature is the ability to keep your key card in your wallet and have it work. Again slim but needing multiple place for your items is not efficient, was not a fan of the carabineer I had to also carry while using the slim wallets.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2022

recommand products