SKU: 27189032023

BCMA/TNFRSF17 His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BCMA/TNFRSF17 His Tag Protein, MouseProduct Specification Species Mouse Synonyms TNFRSF17, CD269, BCM Accession O88472 1 Amino Acid Sequence Met1 Thr49, with C terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 12 17kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at 0. 1 1 mg ml

Product Specification


Species Mouse
Synonyms TNFRSF17, CD269, BCM
Accession O88472-1
Amino Acid Sequence

Met1-Thr49, with C-terminal 10*His MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 12-17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Gene ID: 608, updated on 18-Aug-2023.

Background

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. TNFRSF17 is expressed in mature B-cells, but not in T-cells or monocytes. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27189032023

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Guy
Louisville, US
★★★★★ 5
great product for my beard
Scent: Aged Bourbon
very good product, smells good. Keeps beard soft and controllable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
P
Verified Purchase
Paul Podczervinski
Los Angeles, US
★★★★★ 5
Works great & smells good!
Scent: Sandalwood
I was concerned the facial wash would be too harsh but thankfully I was wrong. Every part of this kit compliments the other. My skin and beard feel noticeably softer, and I haven't had any acne breakouts. The scent is masculine but not too strong. This is now my new routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
C
Verified Purchase
Cleo Beanie
Draper, US
★★★★★ 5
Smells amazing!!
Scent: Sandalwood
My husband loves this set. He has sensitive skin, and loves this product since it doesn’t cause any irritation, plus it smells amazing! The face wash seems to be helping with beard acne, while not drying out the hair like other washes do, and the oil moisturizes well creating a healthy shine. I would say this is well worth your money if you are looking for a full starter kit to try something new and well-rounded for your beard care.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Smells great!
Scent: Sandalwood
My Partner loves the smell and says it makes his beard feel so soft. I would have to agree! The plastic brush is lame, the products are good!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
C
Verified Purchase
Caleb Watkins
Port Orchard, US
★★★★★ 4
Great product at great price...
Scent: Sandalwood
As someone who's had a beard off and on for the better part of a decade, I've gone through my fair share of beard products. For the most part they're all very similar. The washes for the most part clean and leave a very squeaky clean (almost dry) feeling out of the shower. Conditioners help a bit after a wash, but not anything to write home about, the only one I've tried that I really liked was Scotch Porter. Oils help in hydrating, some are excessively oily and just don't look very appealing. Balms will help tidy up the overall shape of the beard, some are not really strong enough and just end up being another layer of oil on the wiskers. Ok, now for this review... So I believe this to be the most natural and most effective line of products I've found to date. First off, the wash, oh my, the wash... I could really just stop right there. This is my favorite of the line. It leaves my beard so soft I find myself not wanting to ruin it with a conditioner. If you try just one of these product, the wash is a must. Next we have the detangler, this is pretty much a leave in conditioner. It softens out the beard even further and adds a slickness to the beard, it feels great. The oil in the set is probably unnecessary since the wash and detangler do such a great job, but in any case it is a quality oil. The reason I say this is because it doesn't really stay oily in the hair, you can feel that after initially applying, it does absorb into either the follicle or skin, whichever it's intended to. As I mentioned, there are some oils that just don't do that, it's just greasy all day long. The balm is probably my least favorite of the line, but only because it's not a very strong holding balm. It's kind of like I mentioned, another layer of oil. This one does also absorb so it's ok. I prefer a more tacky balm with more wax rather than oils. Also, the scent of this line is a subtle chocolatey vanilla kind of smell. It's a very pleasant scent that my wife also enjoyed initially. However after about a week or so of using the product, I no longer get so much as a whiff, which is fine, I find that to be common with many of these beard oils and such. So, overall a great set of products that leave my beard feeling soft and hydrated all day long, it also feels like quality, in the sense that it does absorb. It doesn't feel like you just applied baby oil all over your face. I cannot stress this point enough, there are some "name brand" beard care product that feel as such. That's why this product line really stands out to me. Five stars...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products