SKU: 27469110363

Rat CGA Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 5 - Sep 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat CGA Protein, His TagProduct Specification Species Rat Synonyms Glycoprotein hormones alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, Follicle stimulating hormone alpha chain (FSH alpha), Follitropin alpha chain, Luteinizing hormone alpha chain (LSH alpha), Lutropin alpha chain, Thyroid stimulating hormone alpha chain (TSH alpha), Thyrotropin alpha chain, Cga1 Accession P11962 Amino Acid Sequence Protein sequence (P11962, Leu25 Ser120, with C

Product Specification


Species Rat
Synonyms Glycoprotein hormones alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, Follicle-stimulating hormone alpha chain (FSH-alpha), Follitropin alpha chain, Luteinizing hormone alpha chain (LSH-alpha), Lutropin alpha chain, Thyroid-stimulating hormone alpha chain (TSH-alpha), Thyrotropin alpha chain, Cga1
Accession P11962
Amino Acid Sequence

Protein sequence (P11962, Leu25-Ser120, with C-His Tag) LPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS

Expression System HEK293
Molecular Weight Predicted MW: 12.3 kDa Observed MW: 24 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Glycoprotein hormones alpha chain (CGA) is a common subunit shared by several pituitary glycoprotein hormones, including thyroid-stimulating hormone (TSH), follicle-stimulating hormone (FSH), luteinizing hormone (LH), and chorionic gonadotropin (CG). It is encoded by a single gene and non-covalently associates with unique hormone-specific beta subunits to form biologically active heterodimers. This 14-20 kDa polypeptide is heavily modified by N-linked glycosylation, which is critical for proper protein folding, heterodimer assembly, and biological activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27469110363

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Red
Battle Creek, US
★★★★★ 5
Best Value For The Money
Color: Black, Size: 36W x 32L
My grandson uses these for work. Well-made and durable. Worth the price. Fit is comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
R
Verified Purchase
Ranae Ledford
New York, US
★★★★★ 5
Good, but size up!
Color: Black, Size: 30W x 29L
These are exactly what I wanted, but as many have stated, you need to size up. I found that going up two sizes (from my usual 28 to a 30) made for a great fit. I love that they come in a 29 length. One anything point is they came with creases in them from being folded in the package for a length of time. I had to steam and press them before wearing. I’ll likely buy them in other colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
W
Verified Purchase
William B. Fisher
Phoenix, US
★★★★★ 5
Great Pants
Color: Khaki, Size: 46W x 32L
Great pants but buy one size up in the waist. They are well made, comfortable, and good looking. They are Dickies brand what more needs to be said.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
H
Verified Purchase
H
Los Angeles, US
★★★★★ 4
order 3 or 4 inches up than your usual waist, run very small in waist
Color: Charcoal, Size: 33W x 30L
arrived with dirt on the bottom legs but amazon helped with that. anyway I weigh 115 lbs and am 5'8 and I am a woman. I know that Dickies these days run super small for their size, so it sounds insane but order up 4 inches than your normal waist size, then run small in the waist and they will shrink a size with a few washings. I ordered a 33 waist and they did shrink probably a size in one wash lol! they are still a bit loose in the waist but not big and I know with a couple more washings they will be just right. I do not like anything skinny fit or with no give. but yah, I love the charcoal gray color, one of my favorite colors, much cooler than plain black. I normally enjoy the Dickies shorts but with these forty something degree afternoons these are my new go tos. I am not a jeans person and I sure as hell with not be wearing pajama pants out in public like these dang younger adults lately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025
A
Verified Purchase
AmazonSmile
Charlottesville, US
★★★★★ 5
Perfect fit every time
Color: Silver, Size: 30W x 30L
These original 874’s are the real deal. Stocked up during the sale and got them for my husband. He loves all the colors and the durability of these pants is incredible. He still has some from 14 years ago! But he wanted a few new ones- and they had more colors so I stocked up and surprised him when I told him how much they cost during the sale. These pants never wrinkle. I wash them hot and air dry- no wrinkling or shrinking. They look great. They’re sewn to perfection. The quality is there and has been for years, a reason my husband only wears these. Quality, value, durability, style, fit. Great for all seasons, they’re not too heavy or too light. Great functionality- pockets for everything . Great even in summer - they are very breathable. Perfect fit every time. Great for heavy road construction or just going for a hike. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025

recommand products