SKU: 28496391429

B7-H6/NCR3LG1 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H6/NCR3LG1 His Tag Protein, HumanProduct Specification Species Human Accession Q68D85 Amino Acid Sequence Asp25 Ser262, with C terminal 8*His DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGSHHHHHHHH Expression System HEK293 Molecular Weight 45 60 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin

Product Specification


Species Human
Accession Q68D85
Amino Acid Sequence Asp25-Ser262, with C-terminal 8*His DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 45-60 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

B7-H6 (encoded by gene NCR3LG1) is a type I transmembrane protein of B7 family. It consists of two extracellular Ig-like domains (IgV and IgC), an α-helical transmembrane domain, and a C-terminal sequence homologous to group-specific antigen (GAG) proteins. This C-terminal sequence has various signaling motifs, including ITIM-, SH-2-, and SH-3-binding motifs. B7-H6 can bind its receptor NKp30 to exert anti-tumor effects by helping NK cells to recognize abnormal cells. B7-H6 is expressed in several tumor cell lines, both in vitro and in vivo, including esophageal squamous cell carcinoma, oral squamous cell carcinoma and breast cancer. but remains undetected in healthy cells thus far, and is therefore an excellent tumor marker. In recent years, B7-H6 expression has been reported to be upregulated in certain cancers and to be associated with tumor differentiation, stage and progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28496391429

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jenny
Draper, US
★★★★★ 3
Sometimes they arrive chewy and great, other times stale and hard as a rock!
Size: 1 Count (Pack of 16)
My dog loves these added to her toys, but alot of time they arrive hard as a rock.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
H
Verified Purchase
Higgie
Fort Morgan, US
★★★★★ 5
If your dog pops with his canines and shreds with his front teeth, this is for you. I have nothing but praise for this toy.
Size: One Size, Style: Bumpy Ball
This is one of the few balls I have purchased that my dog does not destroy. I am surprised at the negative reviews here and have been doing some thinking about why one dog destroys this ball and another does not. Perhaps it is the type of chewer we own? Or because he has a narrow jaw rather than a broad one like a pit bull? My Airedale Terrier likes to shred, preferring to use his back teeth to pop or crush and front teeth to pull apart tennis balls, stuffed animals and the like. I don't know if that will help anyone in making the decision to buy or not to buy this toy. The ball has many dimples where my dog's teeth have sunk in but he has yet to take a chunk out of it. I bought two of these from Marshall's three or four months ago and I play with my dog twice a day, so lots of use here. After I realized what I'd found I promptly ordered two more from Amazon because I wanted to insure I would have them around for a long time. All I can say is that this toy has been a lifesaver for me. My extremely active one year old Airedale Terrier needs a lot of exercise and this ball satisfied that need for us. It is fun for him and I giggle at his antics as he attempts to follow the unpredictable path of the bumble ball. I throw the ball for him from my porch, trying to toss it so it goes over our truck, which my husband leaves in the driveway. If the ball hits the truck, no harm done and more unpredictable for my boy! I can toss the ball around the house without worrying it will break a window. My dog loves to pick up toys and throw them in the air when he plays. He tossed a marrow bone into the air and when it landed I had a nice half inch gash in our coffee table. No more marrow bones in the house for him. I have nothing but praise for this toy and am grateful to have found it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2016
W
Verified Purchase
William Belden
New York, US
★★★★★ 5
Great Toy
Size: One Size, Style: Stick
I breed German shepherds. This toy is a soft formed stick made of a memory foam/ rubber polymer. It’s light weight, very durable, floats and my German Shepherds love retrieving this toy. They are not indestructible but they are a great chewing toy for their price. I usually buy several at a time. This toy will help clean their teeth and is soft enough not to damage their teeth. It’s a favorite item for my dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2024
N
Verified Purchase
Nurse Ratched
Natrona Heights, US
★★★★★ 5
SPECTACULAR dog chew toy!
Size: One Size, Style: Ball
If you look at my profile, you will see that I have bought and reviewed a LOT of dog toys! My boxer is an "aggressive" chewer and we go through dog toys quickly in my house. This has been one of my very favorite chew toys that I have ever purchased. This company sells quite a few of these chew toys in different shapes. This ball is made from a very light foam rubber (I think) material. When I showed it to my husband, he said "that won't last 5 minutes" and I had my doubts too. However, this ball has proven to be EXTREMELY durable! Because it is made from the foam material, it has a lot of tooth sized holes in it after she chews it, but she has been unable to chew the toy apart. I bought another of these chew toys made from the same material in a different shape thinking surely there was some accident that the toy had held up for so long. Nope, the new toy has held up just as well! The toys float in water and are very light and easy to throw. Overall, I will be buying more of these toys and would recommend this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2015
R
Verified Purchase
R. Smith
Waukegan, US
★★★★★ 1
Didn't last one day.
Size: Large, Style: Duck Slingshot, Size: Large, Style: Duck Slingshot
Didn't last even an hour. This damage wasn't from the dog either, it looks like it let loose from the stress of just trying to launch it! It doesn't fly near as far as the discontinued Pig Slingshot toy. Bring back the pig, please. I also ordered the other listed Hyper Pet flying fowl, and it flew the same distance as this one, and has lasted through the day (but needs to be heavier). But for this one, perhaps they needed to double stitch the area under the 'chin'? I'll try to return it. It looks like it should be more durable, but at least that part isn't. Second one: I chose the replacement, instead of a refund because my dog loves me shooting the toys into the yard. He saw the new duck, and was excited. Six shots in and the seam on the bottom of the head was already separating. By 10 or so times, it was getting concerning as the seams were opening enough I was concerned that it would lose its filling. I'm disappointed, and so is my dog. Just in case anyone is wondering, I never let him alone with this, and still feel, even more so, that the failure is the stitching on the bottom of the head, right at the point where the most stresses of launching it are focused. I'd strongly recommend that Hyper Pet use two layers of full canvas over that area, and also Bring Back The Slingshot Pig, PLEASE... The second picture is the second Duck, and my 7 month old. He wasn't ready to end the session. The problem, for us, is that the 'dog run' isn't very long, and all of the other toys I have are bazooka style launching devices that I can't use yet as they would fly far over the fence. Ironically one is from Hyper Pet, and is amazing. Works so well. Too well?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2022

recommand products