Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 23 - Aug 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRA1 His Tag Protein, HumanProduct Specification Species Human Accession O75019 1 Amino Acid Sequence Pro17 Asn461, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75019-1 |
| Amino Acid Sequence | Pro17-Asn461, with C-terminal 8*His PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-85 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LIRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA1, also known as CD85i and LIR-6, is a Protein Coding gene. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Mature human LILRA1 consists of a 445 amino acid (aa) extracellular domain (ECD) with 4 Ig-like domains, a 21 aa transmembrane segment, and a 7 aa cytoplasmic tail. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2. Among its related pathways are Innate Immune System and Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. Gene Ontology (GO) annotations related to this gene include transmembrane signaling receptor activity and antigen binding.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 9 reviews
Sort
Product Reviews
★★★★★ 4
Good protein option with good taste
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
These shakes are delicious. There are a few things about them I love. First, they are gluten-free. Next, they are low in sugar. They are also low in calories, and are very tasty. They do not leave an aftertaste like a lot of protein shakes. I do find you need to really shake them well to get a good consistency. They are not clumpy, but sometimes have strands that give them a weird texture. However, this does not happen if you shake them really well. I like to blend mine with fruit, and never have this problem when I do that. They are also really convenient because you can grab them and go. The serving size is perfect too. I would recommend these if you are looking for a low sugar, protein drink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
★★★★★ 5
Love this Protein Drink!
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
MY husband and I are addicted to these shakes. The flavor is good and its packed with protein and other vitamins and minerals. Great afternoon snack.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
★★★★★ 5
Great product but prices are now the same or more than local stores
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
I really love this product, especially in these bottles. I drink it everyday. I bought it several times but they raised the price so I buy it locally now
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
Hands down best protein drink
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
Best protein drink out there. Chocolate is the best flavor. My opinion anyway. Helped me lose 65 pounds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
★★★★★ 5
Incredible, perfect
Flavor Name: Zero Ultra, Size: 16 Fl oz (Pack of 15)
This is definitely the best flavor of Monster! No calories, but full flavor. I can't get enough of this stuff. It does cost a bit, but it is worth getting every once in awhile as a treat. I love it, and I would definitely recommend it. There is a high level of carbonation, so it doesn't go flat too quickly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
recommand products
Custom Black Old Gold-White Geometric Shape Sublimation Volleyball Uniform Jersey
16.99
The Light Source SCB 30" Safety Cable - 1/8" Aircraft cable with Snap Hook (Black)
11.99
Cameo Pro CLF4FC Professional Fresnel Full Color - Includes Barndoor and Gel Frame (RGBW)
2071.49
The Light Source SLCM Slim Claw (Silver)
88.99
Custom Black Red-White Geometric Shape Sublimation Volleyball Uniform Jersey
16.99