SKU: 29978959269

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29978959269

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Teresa mosier
Massapequa, US
★★★★★ 5
Pug approved
Size: Extra Small, Color: Blue
Bought for my pug to teeth on when he was a puppy. He's almost year old and he still packs his little bone around
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
Great for teeth cleaning
Size: Extra Small, Color: Blue
My dog loves it. She’s a Yorkie and it’s perfect for her.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
T
Verified Purchase
Tina
Fort Morgan, US
★★★★★ 1
Made for very small dogs- don’t buy if you have medium to large dogs
Size: Extra Small, Color: Blue
2 of my 3 dogs chewed right threw it <5 minutes of getting it causing a potential choking hazard. It’s small not durable but definitely soft. Only suitable for very small dogs
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
M
Verified Purchase
Madison G
Waukegan, US
★★★★★ 5
Perfect for light/moderate chewers
Size: Extra Small, Color: Blue, Size: Extra Small, Color: Blue
My dog wouldn’t stop biting on the toddlers plastic dinosaur toys, so I got him this because it’s similar to plastic. But not hard enough to where it could damage his gums, also not soft enough to break apart. It’s perfect and he’s very happy with it. My dog is 6 LB toy poodle for reference, I would say this is suitable for small dogs. I saw reviews saying that their dog absolutely destroyed it immediately, but then in the review pictures their dogs were baby bulldogs/german shepards! This isn’t meant for breeds like that, but if you have a smaller dog with smaller teeth then this is ideal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
K
Verified Purchase
Kayann
San Leandro, US
★★★★★ 5
Quality and long lasting
Size: Extra Small (Pack of 2), Color: Blue
Highly Recommended!!! My 9 Shihtzu’s absolutely love the smell the durability and taste their thick so last long Thankfully I have to buy these every month!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026

recommand products