Pay in installments of $42.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Monkeypox virus A35R, His TagProduct Specification Species MPXV Synonyms Mpox, Monkeypox Accession Q80KX2 Amino Acid Sequence Protein sequence(Q80KX2, Val57 Thr181, with C 10*His) VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 4kDa Actual: 15kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | MPXV |
| Synonyms | Mpox, Monkeypox |
| Accession | Q80KX2 |
| Amino Acid Sequence |
Protein sequence(Q80KX2, Val57-Thr181, with C-10*His)
|
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 15.4kDa Actual: 15kDa |
| Purity | ＞95% by SDS-PAGE |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Monkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy