SKU: 32606045499

Human IgE, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgE, His tagProduct Specification Species Human Synonyms Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE Accession P01854 Amino Acid Sequence Protein sequence (P01854, Lys208 Gly427, with C His tag) KCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG Expression System HEK293

Product Specification


Species Human
Synonyms Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE
Accession P01854
Amino Acid Sequence

Protein sequence (P01854, Lys208-Gly427, with C-His tag) KCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG

Expression System HEK293
Molecular Weight Predicted MW: 26.3 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ig epsilon chain C region is a protein that in humans is encoded by the IGHE gene. IGHE has been predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. IGHE has also been predicted to be located in extracellular region, a part of immunoglobulin complex, circulating, and active in external side of plasma membrane. Immunoglobulin E (IgE) are antibodies produced by the immune system. Each type of IgE has specific "radar" for each type of allergen. IgE-mediated food allergies is when the immune system reacts abnormally when exposed to one or more specific foods such as milk, egg, wheat or nuts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32606045499

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
GN Phx
Dallas, US
★★★★★ 5
Great frother and well built
Color: Black, Size: Rechargeable
I don’t usually write reviews, but since I’ve been helped by so many reviews from others, I wanted to share my thoughts on the InstaWhisk Milk Frother. This is a great frother. It really whips cream into a tasty, rich froth. My wife and I have tried cheaper battery-operated frothers in the past, and while they worked fine at first, they didn’t last very long. The InstaWhisk feels well built and works great. Pro tip: The frother may be a little too powerful at normal speed, so you might need to lightly “feather” the power button to keep the liquid from overflowing the cup. Once you get used to it, it works really well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
K
Verified Purchase
Ken
Birmingham, US
★★★★★ 5
Great frother/stirrer especially for the price.
Color: Black, Size: Rechargeable
Best one available. Have used cheap ones from the store that work pretty good, but batteries are a pain. This is rechargeable and it has a push button that allows you to start it right away without having to turn it on to start it kind of like a power drill. If you start to press it it goes slow the harder you press the faster it goes. The different attachments are great. We use it for both coffee frothing as well as mixing up electrolyte drinks with water with the included mixing attachment. Crazy powerful and easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
T
Verified Purchase
Techie
Battle Creek, US
★★★★★ 5
Strong motor. Works great
Color: Black, Size: Rechargeable
I really like this frother. The fact that it’s variable speed, rechargeable, and can spin at a high rate are all great features. I use it to blend collagen powder and cream into my coffee every morning. Also sometimes use it to Blend drinks. Strong motor. Like that the whisks are removable for cleaning and that it comes with different ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
J
Verified Purchase
John Wagner
Lake Worth, US
★★★★★ 4
Works well, long use on single charge, high torque - be careful when starting
Color: Black, Size: Rechargeable
Not the most inexpensive powered whisker bur I've used other Typhor products and found them reliable for the task designed. I fell they don't cheap out on the rechargeable battery so I don't fell they will catch fire, as we are hearing about from other cheaper rechargeable items. I liked 2 things about this model the speed control is by a pressure single switch which I can control, not just pick speed 1,2,3. The swappable tips allow for different uses. I don't drink coffee but use the item to whisk eggs for an omelets and it has the torque to mix them without effort. In Fact need to only use half power else it will splatter out of my mixing vessel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
H
Verified Purchase
Hanna
Louisville, US
★★★★★ 5
Still The Best Frother Ever!
Color: Black
I love how it is easy to use, how it holds a charge, and how much power it has. I've only charged it once since I got it & I've been using it on a daily basis!!! Though it isn't a long time, I'm happy with it so far! I definitely will recommend it to anyone looking for a great frother. If you are looking for one, look no further! You won't be disappointed! I've read some comments where they found it to be too strong that their drink spilled everywhere. But for me I have not had any incident of spilling over. I have used it both for my coffee and my matcha tea and it worked great without any spilling over. You just have to start with the lowest power and ensure that you have a large enough container to have a room for your frothing. My sister tried to use it recently during her visit to make us matcha tea. However, she experienced spillage all over the cup, because she had used a small cup. Otherwise, she liked it very much and said she will get one when her battery operated one stops working... Another thing I like about the product was the customer service that I had received. When I got my first order which came quickly, it wasn't working after having charged it over 24 hours. It was not turning on at all. I returned it and ordered a replacement which I received within a day or two. This time after charging it for the recommended amount of time, I was a bit skeptical when I turned it on. However, I was pleasantly surprised that it worked like it was supposed to and it has been working ever since having charged it only once so far. I may come back and give an update depending on how it does after 6 months of use, so keep in tune... I don't know if there is a way to write a new entry as a follow up to the old entry, so I'm going to add my follow up comment over here. May 23, 2025 - I love my frother more than I can say in words. It's functionality has not changed a bit from the time I have purchased it. It charge lasts several weeks to few months before I charge it again and the power is still the same. Recently I decided to buy another one for my office use. I like the white color and so tried it but that one wouldn't even turn on. And then I got a gray one to have a different color. That one was much weaker than the black one I own. Then I replaced it with another gray one within few days. I tried it and it was exactly the same as the one I already replaced. So then I decided to go with a black one again hoping that it would be the same as the one I have. The black one did much better than the gray ones in the strength or power of the frother. However, it is weaker than the one I already have been using since last August. While I am not very happy with the quality being inconsistent in all of the ones I have tried including the recent pictures of the black one, I have decided to keep the black one because it is relatively better than the gray ones I tried. What I don't understand is why there is inconsistency in the quality of the same product by the same maker. I am beginning to wonder if the black one I purchased in Augusta last year was anomaly of a quality and a good way. Maybe I lucked out on my older black frother, but I'm unsure if quality is going to get better if I were to order another one. I have a sister who is a pro in making coffee drinks and she was the reason I had ordered this frother to begin with. She uses a battery operated one at this time and I have been thinking about getting her one like mine. While I am still skeptical, I am going to give it a shot and order her one sometime soon. If it doesn't work, I guess we will return it back. But one thing that I am grateful is that I have been able to return every one of those that I have tried recently with no issues. I hope that I don't have to return my most recent purchase in black. I was not even able to review the new purchase because of the item being the same color which is crazy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2024

recommand products