SKU: 32880107750

NKp30/CD337 Fc Chimera Protein, Cynomolgus

Sale price$198.00 Regular price$220.00
Save 10%

Pay in installments of $55.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NKp30/CD337 Fc Chimera Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms Natural killer protein 30,NCR3,CD337 Amino Acid Sequence Leu19 Gly137, with C terminal human IgG1 Fc

Product Specification


Species Cynomolgus
Synonyms Natural killer protein 30,NCR3,CD337
Amino Acid Sequence Leu19-Gly137, with C-terminal human IgG1 Fc LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 50-60 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32880107750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
peter contino
Whiting, US
★★★★★ 5
My dog loves this toy!
Color: Bunny (Gray), Size: Large, Color: Bunny (Gray), Size: Large
High quality, big toy, perfect for a medium to large size dog. After a few months of serious chewing I had to buy another one, but well worth the money! Rocky loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
D
Verified Purchase
Denise Boyd
Bozeman, US
★★★★★ 4
Great toy but if your dog is an aggressive chewer, please think twice.
Color: Crinkle Chicken (Brown), Size: Large
I received this on May 23rd and on June 8th, after playing with this thing every day, our recently acquired 36 lb dog finally ripped it open and got out all the plastic and the squeaky part. Lily Belle will miss you, chicken. Lily loooooved this toy! She'd toss it in the air, chew on it, pull it with her teeth etc. but as much as she loved it, we won't replace it. It's just not durable enough for her. If your dog is an aggressive chewer, you might want to try a different toy. I hate that this lasted just a smidge over two weeks because Lily seemed to truly enjoy this toy. RIP, squeaky chicken!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
L
Verified Purchase
Literally doesn’t work
Massapequa, US
★★★★★ 5
Great Value Toy
Color: Crinkle Duck (Blue), Size: Large, Color: Crinkle Duck (Blue), Size: Large
This toy has been one of my dog’s absolute favorites. He gets excited every time he sees it and will carry it around the house, toss it in the air, and keep himself entertained for a long time. The shape and texture seem perfect for him, and it quickly became one of his go-to toys over everything else in his basket. What I really like is that it holds up reasonably well for the price. It’s definitely not indestructible, and after a lot of play, it will sometimes start to rip—usually around the feet first since that’s where my dog tends to grab and chew the most. But honestly, considering how affordable it is, I don’t mind replacing it when needed. It’s inexpensive enough that rebuying feels worth it because he genuinely loves it that much. I’d rather keep buying a toy he is obsessed with than spend more on something that just sits untouched. It’s fun, cute, and keeps him happy, which is what matters most. Overall, I’d definitely recommend it for dogs who love plush toys and playful chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
L
Verified Purchase
Lady B
Charlottesville, US
★★★★★ 5
Best affordable squeaker toy
Color: Crinkle Chicken (Brown), Size: Large, Color: Crinkle Chicken (Brown), Size: Large
my dog is obsessed with this toy, this has became his new comfort toy and after having this for about four months the legs are falling off but it’s very durable. The squeaker also moved from the head of the chicken to the body of the chicken but that’s after it was played with every single day. I love that it has two squeakers and it’s the perfect toy for my dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 5
My dogs favorite toy EVER
Color: Crinkle Chicken (Brown), Size: Large
I have a Belgian Malinois who loves any and every toy, but this one is definitely her favorite. She will walk around the house constantly carrying it in her mouth, which is honestly adorable to watch. The squeakers only lasted a couple of months, but I don’t really consider that a downside—I’m kind of grateful they didn’t last forever given how much she plays with it. It still remains one of her most-loved toys even without them. My only word of caution is that if you work from home, this toy makes a lot of crinkling noise. And I mean A LOT. It’s great for keeping the dog entertained, but it can definitely get a little frustrating for humans trying to focus or take calls. Overall, it’s been a big hit in our house and easily one of her favorite toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026

recommand products