SKU: 33455517431

CD3 delta His Tag Protein, Cynomolgus

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 delta His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms T3D, CD3 DELTA, CD3D Accession 95LI8 Amino Acid Sequence Phe22 Ala105, with C terminal 8*His FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Synonyms T3D, CD3-DELTA, CD3D
Accession 95LI8
Amino Acid Sequence

Phe22-Ala105, with C-terminal 8*His

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3 delta, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3 delta plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33455517431

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Anna
Cuba, US
★★★★★ 5
Nice mask! Caviar
Scent: PDRN, Size: 4 Count (Pack of 1), Scent: PDRN, Size: 4 Count (Pack of 1)
The first 3 pictures were taken after the first hour and a half. The second 3 pictures were taken at 2 hours. The mask had a hard time dissolving underneath my eyes and around my chin area mostly but everywhere else it hardened within the first hour or so. I will try to wear it for longer than 2 hours next time. To see if that changes, but my skin feels really nice right now. It's a little sticky, but it looks healthy and has a nice glow. Application is easy. I love that its separated into 2 parts. Doesn't fit well around the nose between the eyes and doesn't cover my entire face but its a great mask. I tried the caviar one this time. I have the collagen ones as well but these have better reviews. They seem to work effectively, for a nice glow and self pamper session.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
M
Verified Purchase
Mom who does everything
Birmingham, US
★★★★★ 5
My Favorite Mask
Scent: Collagen, Size: 4 Count (Pack of 1)
I’ve been really impressed with this Bio-Collagen hydrogel mask! It feels incredibly cooling and soothing on the skin, especially after a long day. The overnight wear is a huge plus—you wake up with your skin feeling noticeably more hydrated, plump, and smooth. It doesn’t feel heavy or sticky, and it stays in place better than most sheet masks. After a few uses, I’ve noticed my skin looks more refreshed and even, and my pores appear a bit more minimized. It’s a great option when your skin needs a little extra boost or before an event when you want that “glow.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
F
Verified Purchase
Firethorn
Belleville, US
★★★★★ 5
Love ❤️ this product! 100% recommend!
Scent: Collagen, Size: 16 Count (Pack of 1)
My initial encounter with these was until TikTok but I ordered them from Amazon for myself and my daughter for convenience and Prime shipping. There were two choices I think the one is a four-pack and the one I got is a 16 pack. The 16 pack will last you 4 months if you're doing it once a week as instructed. I open the top and two sides when I'm doing it just to have accessibility and to be able to use the remnants liquid in the pack after I'm done applying the facial part I put the liquid in the pack on my neck and chest. They are a little slippery when you take them out. I watched a video on how to apply it and did the bottom part first and then the top part sometimes I have to snip the top part near the nose to get it to fit properly but you don't have to in general. There are three pieces that are left over the two eye pieces and the lip piece. You can put them below your eyes or above your eyes on your brows and then put the mask over them which is what I do. Or you can put them under your eyes and put the mask over them but I find it doesn't absorb all the way in that location due to the double thickness I guess. The lip one you can put over your lip or put it on vertically over your throat where the skin can get a little saggy. Once you have it on it's best to sit back and relax for 30 minutes or so at about a 45° angle so it doesn't slip off. After about 10 to 15 minutes it doesn't slip around as much and after 30 it's obviously started absorbing and tends to stay pretty well. I haven't noticed any staining on the pillows or anything like that from it and by morning actually by 4 hours later it's completely absorbed and all you have left on your faces the plastic that it was attached to. You just pull that off and throw it away. It's white when you put it on and it's clear when it absorbs. I definitely noticed an improvement in my skin quality and the collagen sinks in easily and less about a week. I am a redhead with delicate skin and I haven't had any reaction to this product at all I know that other masks have caused problems for friends but I've used this one for over a year now and I love it. My daughter and I both use it weekly and they're easy to take with you if you're traveling great way to pamper your skin after a day outside on the beach. The price is reasonable for what it is and what it does. I've gotten several compliments on my skin and I'm over 60 so that saying something for the results! All in all this is a very good product, it doesn't smell and doesn't seem to have any impurities like some others. My skin isn't irritated by it and looks great afterwards. If you're wondering if it washes off once it's soaked in you can wash your face all you want but you're just going to have beautiful glowing cheeks. I wouldn't hesitate to recommend this or give it as a gift!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2025
M
Verified Purchase
Maria Z.
Carnegie, US
★★★★★ 5
Great value, comfy, cozy, perfect!
Size: 36" x 36", Color: Grey, Size: 36" x 36", Color: Grey
My dog loves this bed. So do my husband and I. Firm, fuzzy, comfy, security and great value for the price. I recommend it and so glad I purchased it!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
M
Verified Purchase
Michael L.
Phoenix, US
★★★★★ 5
Super dog bed
Size: 23" x 23", Color: Beige
This review is from my dog Beau, “I love my new bed. It’s cushy and fits my 15 pounds of fluff and fur beautifully. I can stretch out and sleep on my back if I want. I really appreciate that it didn’t have any funky chemical smell when it arrived. My mom ordered the sand color to match my fur. She says it looks just like the picture. It’s really soft and comfortable, I won’t leave it long enough for her to wash it. She had to order a second one for the kitchen so she could finally wash the original. By the way, it washed perfectly and didn’t shrink an inch. “
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2025

recommand products