SKU: 34674896475

Human SAA-1

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SAA-1Product Specification Species Human Synonyms Serum amyloid A 1, SAA1 Accession P0DJI8 Amino Acid Sequence Protein sequence (P0DJI8, Arg19 Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Expression System E. coli Molecular Weight Predicted MW: 11. 7 kDa Observed MW: 11. 7 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a

Product Specification


Species Human
Synonyms Serum amyloid A-1, SAA1
Accession P0DJI8
Amino Acid Sequence

Protein sequence (P0DJI8, Arg19-Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Expression System E.coli
Molecular Weight Predicted MW: 11.7 kDa Observed MW: 11.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Serum amyloid A1 (SAA1) is a protein that in humans is encoded by the SAA1 gene. SAA1 is a major acute-phase protein mainly produced by hepatocytes in response to infection, tissue injury and malignancy. When released into blood circulation, SAA1 is present as an apolipoprotein associated with high-density lipoprotein (HDL). SAA1 is a major precursor of amyloid A (AA), the deposit of which leads to inflammatory amyloidosis. SAA1 has been a clinical indicator and reliable biomarker for inflammatory diseases, chronic metabolic disorders and late-stage malignancy. SAA1 has been extensively studied for its binding to HDL, with results suggesting a role in lipid metabolism. SAA1 has been associated with tumor pathogenesis, and its gene polymorphism is a contributing factor to certain types of malignant tumors. SAA1 has also been shown to affect the tumor microenvironment and contribute to tumor cell metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34674896475

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steve in Florida
Carnegie, US
★★★★★ 5
Awesome chair definitely recommend
Color: Blue, Color: Blue
It was amazing the color was spot on and it was very very easy to put together and the size is amazing for my 11 year old daughter maybe not for an older person it doesn’t recline as much as it says so if you want a reclining chair maybe I don’t recommend this chair but the quality is amazing and the adjustment capability is incredible the noise level is at 0 it is an amazing chair we just got it so I don’t know so much about the dupability so if you want this chair for a child or a tween maybe even a teen easy to put together beautiful blue color this is the chair for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
R
Verified Purchase
Rocky hardcore
Houston, US
★★★★★ 5
Easy instructions, comfortable cushions
Color: Pink
I just put it together and I love it!!! It's so comfortable and it was easy to put together. You can rock it back and forth which helps your back. The seat is very wide and the cushion is thick. Pink is my favorite color, and this chair satisfies my pink obsession.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
L
Verified Purchase
LA Living
New York, US
★★★★★ 5
Wonderful chair
Color: Dark Black
I bought this office chair as a sewing tool, you might say. I felt that having an office chair on wheels would get me from the sewing machine to the ironing board and then to the cutting board and back to the sewing machine. I was having to get up and down to get around to all these places before and this saves me so much time and effort. I’m 71 so when the box came I was hesitant to try to bust into it and put it together but it went together so easily. It’s very comfortable and the lumbar support feels great on my low back. When I first sat down after the assembly process, the chair cushion tipped down in the front but after contacting the support team I was advised to tighten the tilt tension located under the chair and that fixed me right up! All and all, my chair is the perfect addition to my sewing area at a very affordable price. I couldn’t be happier!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2024
S
Verified Purchase
SP
Lowell, US
★★★★★ 4
Comfortable, affordable, and great for small spaces!
Color: Light Purple, Color: Light Purple
I had previously left a review of two stars, but have since deleted that review after I've owned the chair for a few weeks now. Initially, I stated the chair was uncomfortable and not cushioned at all. But this issue quickly resolved after sitting it for a longer time, it seems the cushion molds to you. So it may be uncomfortable the first few times sitting on it, but it eventually softens. The cushion is now soft yet sturdy. You don't sink in too much, but it's comfortable for sitting for long periods of time. I personally enjoy the mesh back as well, it supports my lower back and doesn't cause back pain. Normally I have to use a cushion of my own to support my lower back for most chairs, but this one actually supports me in a way that doesn't require an extra cushion - so that's really nice. The chair is fairly on the smaller end, which is perfect for low desks or tight spaces, which is exactly what I wanted. The height can be adjusted, but even at the highest setting, it is still fairly low. Keep that in mind - it may not be super comfortable for those over 6 ft. The arms flip up which makes storing it under a low desk very easy. The cushion is thick and very accurate to the picture. I love that it is lightweight and doesn't make much noise when rolling the chair. It also feels very sturdy. Some of the reviews say it feels flimsy, and I don't know if some are just assembling it incorrectly, because for me this thing is very strong and holds up quite nicely under my weight. Overall, this is exactly what I wanted for my personal living space. A chair that's not too bulky, but comfortable enough to sit in for long hours. It functions as advertised for this purpose. One final thing -- the color selection is gorgeous. I bought the light purple color and it fits my setup nicely! Color was accurate to the picture, and looks very cute and adorable in my space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
C
Verified Purchase
Christine Franzone
San Leandro, US
★★★★★ 5
Exteremly comfortable
Color: Dark Black
Reasonably priced, very comfortable l, easy assembly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products