SKU: 3597217334

Pig Intrinsic Factor Protein, His Tag

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 5 - Sep 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Pig Intrinsic Factor Protein, His TagProduct Specification Synonyms Cobalamin binding intrinsic factor, CBLIF Accession A0A8D1ENZ1 Amino Acid Sequence Protein sequence (A0A8D1ENZ1, Ser27 Try425(S90T, R247Q), with C His Tag)

Product Specification


Synonyms Cobalamin binding intrinsic factor, CBLIF
Accession A0A8D1ENZ1
Amino Acid Sequence

Protein sequence (A0A8D1ENZ1, Ser27-Try425(S90T, R247Q), with C-His Tag) STQTRSSCSVPSAEQPLVNGIQVLMEQSVTSSAFPNPSILIAMNLAGAYNTEAQELLTYKLMATNTSDLTTGQLALTIMALTSSCRDPGNRIAILQGQMENWAPPSLDTHASTFYEPSLGILTLCQNNPEKTLPLAARFAKTLLANSSPFNMDTGAMATLALTCMYNKIPVGSEEGYRALFSQVLRNTVENISMRIQDNGIIGNIYSTGLAMQALSVTPEQPNKEWDCQKTMDTVLTEIKEGKFHNPMAIAQILPSLKGKTYLDVPHVSCSPGHEVPPTLPNHPSPVPTPAPNITVIYTINNQLRGVELLFNETISVSVKRGSVLLIVLEEAQRKNPKFKFETTMTSWGPVVSSINNIAENVNHRTYWQFLSGQTPLNEGVADYIPFNHEHITANFTQY

Expression System HEK293
Molecular Weight Predicted MW: 45.4 kDa Observed MW: 50-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cobalamin-binding intrinsic factor (CBLIF) is a glycoprotein primarily secreted by gastric parietal cells in pigs, which plays a vital role in cobalamin (vitamin B12) absorption. It binds to dietary cobalamin with high specificity in the stomach, forming a stable complex. This CBLIF-cobalamin complex is resistant to intestinal degradation and is specifically recognized by cubilin receptors on the mucosal surface of the distal ileum, facilitating its active transport into enterocytes. Therefore, CBLIF is essential for the efficient uptake and systemic delivery of vitamin B12, a critical cofactor for DNA synthesis and red blood cell formation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3597217334

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Bright idea
Burns bright. Lasts all night. Took more time to unwrap than it did to install
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
S
Verified Purchase
Sam Rogers
Dallas, US
★★★★★ 3
Looks good but but takes work to put it together.
Parts do not fit together well. Had to take a knife to trim top to make it fit. Plastic nuts and bolts. Light works well and stays lit for hours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2025
J
Verified Purchase
Just-me
Omaha, US
★★★★★ 5
Looks Fantastic
Size: 1 Pack
Very easy to install, and looks very nice. It’s made from a durable composite material, not metal, but it’s built well. No one would know that it isn’t metal. On the pricier side for solar lamps, but you’re buying a quality product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2024
R
Verified Purchase
Robert M.
Alexandria, US
★★★★★ 4
Good product for the price!
Size: 1 Pack, Size: 1 Pack
This light is not bad for being a solar powered product. I have it in the area that receives most of the days sunlight as this area gets full sun (that side of the house gets blasted). The light is on for about 6-7 hours. I am thinking of buying another one. Just note that the housing is plastic.... not super high quality, but it gets the job done for the price point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2021
F
Verified Purchase
Fred
Whiting, US
★★★★★ 5
More expensive and worth it
Color: Bright White Accent Light
Walk away from those 6 for $49. solar lights and buy some of these. They will cost more in the short run but will save you money in the long run. They are very well made of sturdy aluminum from the light head down to the stake. They have glass crystalline lenses. They look good on the path-modern and somewhat understated. These come in 2 varieties-a 40 lumen and a 60 lumen. I strongly recommend the 60 lumen variety. Aside from being brighter, they have a better solar cell and battery. My lights are still on at 6AM after a prior sunny day which is a new experience for me. They also have external, easily accessible on/off and light color (amber vs bright white) toggle switches. I find this feature unique and a game changer. GamaSonic has really listened to customers and created a noticeably better solar light that checks all of the boxes. I strongly endorse this solar light.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2023

recommand products