SKU: 36553995108

Biotinylated CD155/PVR His&Avi Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD155/PVR His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5 Accession P15151 Amino Acid Sequence Trp21 Asn343, with C terminal 8*His&Avi tag

Product Specification


Species Human
Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5
Accession P15151
Amino Acid Sequence

Trp21-Asn343, with C-terminal 8*His&Avi tag WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNIEGRMDHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

65-75kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Kučan Brlić P. et al. (2019) Targeting PVR (CD155) and its receptors in anti-tumor therapy. Cell Mol Immunol. 16(1): 40-52.

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic virotherapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36553995108

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stew1017
Draper, US
★★★★★ 5
Pleasant Surprise
Color: White, Size: 4X-Large
This shirt was a pleasant surprise. I really like the fit, quality, and overall look. I’ve received several compliments every time I’ve worn it. Definitely a great purchase and I would highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
S
Verified Purchase
Stuart
Grantham, US
★★★★★ 4
Check size.
Color: Navy Blue, Size: Large
I normally order a large. This was a little loose. Some may like that. Otherwise, it is a comfortable shirt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
P
Verified Purchase
Patrick Miller
Fort Morgan, US
★★★★★ 5
Fantastic super soft Mock Turtleneck short sleeve shirt!
Color: Navy Blue, Size: Medium
COOFANDY Mens Mock Turtleneck Shirts Short Sleeve Casual Basic T-Shirts Ribbed Solid Pullover Top is fashionable and comfortable with a softness I wasn’t expecting. The fabric is excellent quality and just the right thickness for this time of the year. The sizing was perfect as the mock turtleneck short sleeve shirt hugs my body perfectly. I love the way it looks on me and I plan on purchasing a few more. Great addition to my golf apparel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
J
Verified Purchase
Jay T
Grantham, US
★★★★★ 5
Don’t Pass On This One! Get Every Color!
Color: Black, Size: X-Large, Color: Black, Size: X-Large
I always brace myself when purchasing clothing off the internet because size recommendations don’t always hold true. I’m glad I flowed my mind and bought an XL instead of the recommended XXL. It fits perfectly. The quality was better than I expected and the neckline was a perfect height and the size was just right (my neck is a 19”). The cost was better than what’s offered in stores. The stretch material adds to the comfort and it’s lightweight; which makes it perfect for those that are hot alot…like me. (I’m 5’10”/ 260lbs / usually a XXL)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026
M
Verified Purchase
moshe altman
Omaha, US
★★★★★ 3
Too short on length on the 4XL
Color: White, Size: 4X-Large
I give it only 3 star as the 4 xxxxl are too short on length. Too bad as i was ready to order more but returning it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products