SKU: 36779726716

EPHA3 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHA3 ProteinProduct Specification Species Human Accession P29320 1 Amino Acid Sequence K579 V983(end)

Product Specification


Species Human
Accession P29320-1
Amino Acid Sequence

K579-V983(end)

KRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV


Expression System Baculovirus-InsectCells
Molecular Weight 71.9 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 1mM DTT, 10% Glycerol, 0.05% Briji-35, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36779726716

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tarra
Boise, US
★★★★★ 5
great shelves
Color: C. White - Modern Minimalist Style, Number Of Shelves: 3, Size: 36inches
These are a a great set of floating shelves! They were easy to install, feel sturdy, and look clean and modern on the wall. The set of three is perfect for displaying decor, photos, plants or small storage items while adding extra space without taking up room. Great quality, stylish, and a simple way to upgrade any space. They work perfect for my figurines to be displayed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
KadeeH
Omaha, US
★★★★★ 5
Great shelves
Color: A. Black - Universal Classic Style, Number Of Shelves: 3, Size: 22.5inches
Easy to hang and look great in my office. I love the little divot along the edge. Helps to keep pictures from sliding.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Crystal
Whiting, US
★★★★★ 5
Exactly what I needed for my bathroom refresh.
Color: B. Rustic Brown - Americana Farmhouse Style, Number Of Shelves: 2, Size: 22.5inches, Color: B. Rustic Brown - Americana Farmhouse Style, Number Of Shelves: 2, Size: 22.5inches
I bought these floating shelves in the color Rustic Brown to replace a bulky storage shelf that was making my bathroom feel cramped, and they completely transformed the space. The wood finish looks much more expensive than I expected, and once installed they gave the bathroom a clean, modern, spa-like feel without taking up visual space. Installation was straightforward overall. I mounted one screw in the center into a stud and used drywall anchors for the remaining hardware, and the shelves feel very sturdy. They sit flush against the wall and don’t sag or wobble. I especially love how slim they are while still being deep enough to hold everyday bathroom items, decor, candles, skincare, and small baskets. The color worked perfectly with my bathroom vanity and mirror trim, and the floating design instantly made the room look more organized and intentional. Huge upgrade for a small space. Definitely recommend if you want functional storage that also looks elevated and minimalist.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 4
Good Shelves
Color: B. Rustic Brown - Americana Farmhouse Style, Number Of Shelves: 3, Size: 22.5inches
These shelves are really nice quality and look as advertised. The hardware included was great quality, metal drywall anchors and good screws. They were easy to install, and make even/level with each other. My only gripe is the price, but I'm very satisfied with the product overall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
P
Verified Purchase
Patricia G.
Draper, US
★★★★★ 5
Attractive, easy to install, nicely equipped hardware package.
Color: B. Rustic Brown - Americana Farmhouse Style, Number Of Shelves: 2, Size: 22.5inches
These are pretty doggone nice shelves and I appreciate the fact that they are not made of solid particle board. Yes they are made of an engineered product, but they are lightweight and strong…and look better than particle board products and more costly than their actual price. Easy installation system with the bracket…not fussy like some are. An especially thoughtful touch is the variety of hardware that is included. Also a tiny level for use when installing them. What? …So they can be installed correctly? I was pleasantly surprised by this inclusion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products