SKU: 3706145654

Mouse CD19, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD19, His tagProduct Specification Species Mouse Synonyms B lymphocyte antigen CD19, Differentiation antigen CD19 Accession P25918 Amino Acid Sequence Protein sequence (P25918, Arg19 Gly287, with C His tag)

Product Specification


Species Mouse
Synonyms B-lymphocyte antigen CD19, Differentiation antigen CD19
Accession P25918
Amino Acid Sequence

Protein sequence (P25918, Arg19-Gly287, with C-His tag) RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Expression System HEK293
Molecular Weight Predicted MW: 31.3 kDa Observed MW: 45-60 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

B-lymphocyte antigen CD19, also known as CD19 molecule (Cluster of Differentiation 19), B-Lymphocyte Surface Antigen B4, T-Cell Surface Antigen Leu-12 and CVID3 is a transmembrane protein. CD19 is expressed in all B lineage cells. CD19 plays two major roles in B cells: on the one hand, it acts as an adaptor protein to recruit cytoplasmic signaling proteins to the membrane; on the other, it works within the CD19/CD21 complex to decrease the threshold for B cell receptor signaling pathways. Due to its presence on all B cells, it is a biomarker for B lymphocyte development, lymphoma diagnosis and can be utilized as a target for leukemia immunotherapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3706145654

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Krystle Lamoreaux
Cuba, US
★★★★★ 5
Best Dog Ball!!
Style: Ultra, Size: Small (2 Pack), Style: Ultra, Size: Small (2 Pack)
Our pug has been obsessed with this ball since we gave it to her — she even slept with it. Somehow it’s still in one piece, which never happens. Easily the best dog ball we’ve bought.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
P
Verified Purchase
PrimoCat
Whiting, US
★★★★★ 5
Difficult to destroy. Bounce really high.
Style: Squeaker, Size: Small (2 Pack)
Bought as a gift for a friend's small dog who dismantles tennis balls. He loves them. I have many years of experience with the product (in a larger size) for my big dog. He always had one either in his mouth or near him. They are pretty much indestructible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
M
Verified Purchase
Majesty
Boise, US
★★★★★ 4
High quality, wish it was just a little smaller
Style: Squeaker, Size: Small (2 Pack)
Love these. My dogs would play ball all day if I let them. These are very durable and bouncy. Love that it’s washable. They would chew up the small “tennis” balls to pieces so I love that they can’t destroy these. My only criticism is I wish these were just a little smaller (like the size of the small Kong tennis balls). My dogs can carry it in their tiny mouths but they can’t get their mouth around it enough to chew it to get the squeaker to squeak, which is their favorite thing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
C
Verified Purchase
CA Goose
Massapequa, US
★★★★★ 5
Perfect for little dogs
Style: Ultra, Size: Small (2 Pack)
Perfect size for my 13 pound chihuahua mix. Great bounce and quality feel. Definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 5
The perfect ball for a small to medium dog.
Style: Ultra, Size: Small (2 Pack)
My dog's favorite ball. Perfect size for playing catch and return for a small dog. She loves to chew on the ball. Very durable she has not been able to shred the ball. A great entertainment value. This ball does not squeak.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026

recommand products