SKU: 39350345118

Cyclophilin A His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, HumanProduct Specification Species Human Antigen Cyclophilin A Synonyms Peptidyl prolyl cis trans isomerase A, PPIase A, Cyclosporin A binding protein, Rotamase A Accession P62937 Amino Acid Sequence Met1 Glu165, with C terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH Expression System E. coli Molecular Weight 20kDa

Product Specification


Species Human
Antigen Cyclophilin A
Synonyms Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A
Accession P62937
Amino Acid Sequence

Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH

Expression System E.coli
Molecular Weight 20kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,250mM NaCl, pH 6.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cell Death Dis. 2013 Oct 31;4(10):e888.
2. Biochemistry (Mosc). 2022 Mar;87(3):259-268.

Background

Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39350345118

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cary johnson
Houston, US
★★★★★ 5
its a great fun toy fir all of us
Color: Red-Blue, Size: Medium Size 2 (6")
its very tough so our dogs cant tear it up but soft enough so they get an easy hold. They absolutely love. great dog toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
M
Verified Purchase
momOfMaxx
Fort Morgan, US
★★★★★ 5
zelda‘s “indoor” ⚽️ ball!
Color: Squeaky Green, Size: Medium Size 2 (6")
zelda loves her soccer ball - because of the fabric “tabs”, and the way she treats her toys, we keep it inside. she loves to place all of her toys and bones on our bed, after they’ve been cleaned. this ball is perfect and soft enough to throw it down our steps, where she will run down, retrieve it, and bring it back to the bed. it arrives deflated and comes with the pump and two needles - the pump is not the sturdiest and felt like it was not inflating, but after only having to reflate it once with a bit of air since receiving it ~5-6 months ago, it still holds up!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
D
Verified Purchase
Desy
Fort Morgan, US
★★★★★ 3
Small for a medium
Color: Red-Blue, Size: Medium Size 2 (6"), Color: Red-Blue, Size: Medium Size 2 (6")
I got medium.. and it does not look like a medium ball.. it’s rather small. It’s pretty sturdy and my dogs went crazy for it but it’s definitely not the size I thought it was going to be 😂 my dogs chewed one strap within 5 minutes of having it but they’re dogs and that’s what they do lol. I bought this to be an outside ball for them! It’s pretty light but that’s probably because it’s small. Not soft? But feels like a soccer ball. It also had no smell coming out of the box. Also comes with a pump and an extra thing to put in the ball to pump in case you lose one. I like these balls, I expect them to be chewed up because that’s what I bought them for! Fun for my dogs and they are! But the size… it is not medium and that’s the only reason for 3 stars 😂😂😂 Other then that I recommend, your dog will definitely love this! Inside or outside playing! Alone or with another dog!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025
J
Verified Purchase
James T.
Fort Morgan, US
★★★★★ 5
Great toy for a GSD
Color: Blue Gray, Size: Extra Large Size 5 (9")
My GSD loves to grab the flaps and shake her head with the ball bouncing of the side of her head. This is her favorite toy. I thought she would puncture it but it has held up great since she likes to grab the flaps rather than biting the ball.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
G
Verified Purchase
Gayle
Grantham, US
★★★★★ 5
My puppy LOVEs this ball
Color: Glow in the dark I, Size: Medium
I saw someone recommend this ball in a facebook group. I ordered the first one and it is now sitting somewhere under my deck and I can't find it. My dog loved it so much I had to order a second one. I think the fact there are so many tabs it makes it easy for him to grab it and run so very functional. He doesn't always like to share. The glow in the dark ability I would rate that good at all. The rest of the ball is good quality and holds up well against my aggressive chewer. Its easy to throw or kick. It isn't super hard but is holds it shape well. My dog is about 8 months old and is a mini goldendoodle. I think he was about 18lbs in the video. Perfect size for him. I would definitely recommend, I think your dog would love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025

recommand products