SKU: 39699383268

Human TL1A/TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 Amino Acid Sequence Protein sequence (O95150, Leu72 Leu251, with C His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150
Amino Acid Sequence

Protein sequence (O95150, Leu72-Leu251, with C-His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 22, 25, 28 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39699383268

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NCarr
Los Angeles, US
★★★★★ 5
Excellent frother!!
Color: Black
If super silky froth is your game, this Maestri House frother is the name!! PERFECT froth from day 1!! Very solid and well made for a great price point (especially right now with a $15 coupon)! Even better than the higher priced model we had for years. So glad I took the risk!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
A
Verified Purchase
Amazongirl
Boise, US
★★★★★ 4
Almost perfect
Color: White
Stainless steel. Holds a large quantity of milk (enough for two). Works well with alternative milks. Easy to clean. Easy set up and instructions. Frothing, heating, cold foam, and hot chocolate options. Perfect temp. Not 5 stars because of the constant high pitched squeel sound it makes. Almost enough to make me return it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025
H
Verified Purchase
Heather Hap
Bozeman, US
★★★★★ 5
Hot cocoa every morning!
Color: White
I absolutely love this machine. I make my hot cocoa every morning with it. It is so easy you just put the milk in and high-quality hot chocolate mix. Push the button and then it just whips it up and gives it a little bit of a froth on the top when it’s finished. It’s so fast and easy. It would be a great gift for anybody that likes hot chocolate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
H
Verified Purchase
H. Glezos
Grantham, US
★★★★★ 5
Best way for hot chocolate
Color: Black
works great, I use it for hot chocolate. Easy to clean. Something to consider though the Max light may be a little lower than shown depending on the milk you use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
E
Verified Purchase
Elizabeth Cook
Grantham, US
★★★★★ 2
Check your milk preference when buying this unit. Product Does not last
Color: White
I purchased this frother in mid Oct and less than 90 days later, it's no longer working. The wisk does not spin, and the element does not heat the milk. I am currently working with customer support on a refund / replacement, but so far not happy. I've been told it does not work with 2% organic milk and that I need to switch to whole milk, which will solve my issues. Not sure how whole milk will help with the heating element? This was not disclosed when I purchased the unit. If I had known my milk choice would impact the frother, I would have chosen another brand or product. I like the unit, it's compact, easy to clean, but it did not last.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026

recommand products